Frit-Happens !
June 13, 2021, 09:22:23 AM *
Welcome, Guest. Please login or register.

Login with username, password and session length
your ad here
News:
Where are you?? Add yourself to the NEW FHF map here  | On flickr? Join our Frit Happens group: here

VISIT THE WIKI HERE
Get FH Status updates via twitter @FritHappens

 
   Home   Help Search Calendar Login Register  
Pages: [1] 2
  Print  
Author Topic: Tutorials- the why, the where and the how.  (Read 79941 times)
0 Members and 2 Guests are viewing this topic.
♥♥Tan♥♥
cuntbuckets
Forum Member
*******
Posts: 1300



WWW
« on: April 26, 2010, 08:17:52 AM »

GUYS, TO KEEP THIS SIMPLE THIS IS AN INFO ONLY TOPIC, ONLY POST IF YOU HAVE A NEW TUTORIAL TO ADD WITH THE RELEVANT INFO.

This is the place to come to find who is buying which tutorials and why. To keep things simple keep this a comment free thread, I shall delete ooo and aaa posts as they sneak in, that way we can scroll through and find the info we want quickly.

What info to post

The tutorial name.

The artists name.

Linkypoos to where it can be found.

How much.

How you found it.


If you have found a tutorial particularly awful perhaps its best not to post at all, that way we can save any potential slanging matches and the silence can speak for itself.
« Last Edit: April 26, 2010, 01:02:17 PM by Tan » Logged

Maria Louisa
Maria Louisa
Forum Member
***
Posts: 115


WWW
« Reply #1 on: April 26, 2010, 09:15:31 AM »

I made a list with help of Hayley's at lampworketc..

Aardvark's It's A Wonderful Fish by Cathy Lybarger
http://aardvarkartglass.etsy.com
17 pages, 40+ images, 0.7mb file size, $16.00
This tutorial is all about those little soft glass fish I make. You will find very detailed instructions to create two different fish species, the Shovelnose and the lovable Underbitey. As a bonus, I threw in instruction for making eyelids that are compatible with either fish. Eyelids are essential for expressing anger or fatigue. Those are my two favorite expressions and the ones I use most. I believe that beginners who are motivated will be able to follow these step-by-step instructions.

Aardvark's Screaming Cactus by Cathy Lybarger
http://aardvarkartglass.etsy.com
13 pages, 40+ images, 0.6mb file size, $10.00
This tutorial is all about the Screaming Cactus Bead, describing the process from color recommendations to etching the finished bead. Since it is very picture intensive, I’ve included a “cheat sheet” that will allow you to take a good part of the tutorial with you to the torch with out having to print the whole thing with 16 thumbnails.

Abalone Button by Daniel Caracas of sFd
http://www.artfire.com/modules.php?name=Shop&op=listing&product_id=1154210
$ 5,= 10 pages
Decadent Ultra Shiny Design with reactive glass- Use this tutorial with a Button, Spree, Tab, or other press, or on a free form bead as well.
Bonus material included, this is an intermediate tutorial.
Step-by-step easy to follow instructions on how to create a Abalone Button Bead out of Soda Lime Glass. This e-book is for Glass Lampwork artists who know the basics of hot glass work.

ABC Sculpting Whimsical Beads by Laurie Donnette
http://www.etsy.com/shop/everafterartistry
$ 11,= 31 pages
New tutorial! the aBc's of sculpted lampwork beads,
in this tutorial you will learn to master the basics of bead sculpture, in such deisgns as, Birds, ducks, bees, butterflies, lady bugs, bunnies and button style flowers.
Learn how a few basic techniques can create a forest of friends!
Simple tools and easy to find glass is used.

Alienphant Techniques for sculpting on hollows or solid beads by Loco
http://www.lampworketc.com/ppc/showcat.php?cat=7
20 pages, 41 images, $18.69
Woo hoo after a lot of work and odd twists and some wanting to twist necks, Alien necks that is! It’s done! I cover the building of a loco Alienphant with a detailed description of how I make a hollow bead in 104 COE glass and sculpt on it. These techniques can also be used on a solid base bead, your choice! Additionally I have added a section for sculpting other creatures in glass that should get your imagination revved up to full.

Animal Prints Beads by Diane Woodall and Becky Mason
http://www.etsy.com/listing/26606462/sale-animal-prints-lampwork-bead
$ 10,= 21 pages, 41 photo’s
how to make eight different animal prints, including a zebra, tiger, ocelot, leopard, snow leopard, cheetah, giraffe and a crocodile/alligator. We also included six gallery pictures to whet your appetite and spur your imagination!
Our instructions are very easy to follow and the tutorial is peppered with “oodles” of helpful tips that will make it even easier to make the beads.
In this tutorial we share with you all of our secrets so that you can create animal print beads just like the ones we make. We didn’t hold anything back. Everything we know about making animal print beads is in this tutorial.
You don’t need any special tools to make these beads, beyond a bead press, some basic shaping tools and a marver. Some beadmaking experience is recommended; however, we think that even beginners can learn a lot from our easy to follow instructions.

Arrowhead & Waterfall Shards  by Shari Slonski
http://etsy-lampwork.blogspot.com/
12 pages, 48 images, $15.00
This tutorial will take you through the steps of creating an Arrowhead as well as sharing another one of my Secret recipes for shards. This tutorial is in two parts, Part 1 will be the shard secret recipe “Waterfall” and application of them, Part 2 will be the Arrowhead tutorial. This e-zine is for Glass Lampwork artists who know the basics of hot glass work.

The Art of Beads V3 (Opalinos, Alabasters and Enamels) by Rocio
http://www.fineartbyrocio.com/books.html
$ 19,95
A complete guide to Opalinos, Alabasters and Enamels and how to create colors reactions and new color combos.... including silver colors all in 104 coe!

The Art of Beads V4 (Glass Bead End Caps) by Rocio
http://www.fineartbyrocio.com/books.html
$ 9,95
This tutorial will change how you complete your fine glass bead jewelry.

The Art of Beads V5 (104 COE Geode Beads) by Rocio
http://www.fineartbyrocio.com/books.html
$ 14,95
This Ebook shows how to layer silver colors and bevel windows into beads to create amazing geode effects!

Artifact Series Lampwork Bead by Jennifer Geldard
http://www.etsy.com/shop/glassgirl?section_id=5626039
$ 18,=
This listing is for a step-by-step tutorial on making one of my my Artifact series focal beads.

Baleen Bead by Michael Barley
http://www.etsy.com/listing/43543599/baleen-bead-tutorial
$ 25,= 2,1mb
This tutorial explains in detail the steps that I take to make my Baleen Bead. There are eighteen pages with clear and concise photos for each step.

Basic Round Donut Shaped Bead by Beads by Laura
http://www.beadsbylaura.co.uk/BBLDownloads.htm
£4.99 10 pages
I know what you're probably thinking. A round bead tutorial? Isn't that a bit basic?
Well yes. But it's probably one of the most important things a beadmaker will ever learn.
Over the past five years I've taught many people how to make round beads and when I teach total beginners I tell them that in lampworking making a basic round bead is one of the hardest things to master. There is so much to learn and so much to remember.
I've decided to write down all I know and all the advice I have when it comes to making a basic round bead. This will hopefully be quite useful for beginners and intermediate beadmakers alike. I've taught intermediate beadmakers who can't make consistently round beads. I'm hoping that my waffle (and be warned, there's lots of it) will help you tame that molten glass.
In this ten page tutorial I show you how I make a round bead in detailed step-by-step photos and I also show you how to make consistently-sized beads. There's a section on troubleshooting too which should help you with any wonky bead issues you may have.

Batik Bead by Anne Ricketts
http://www.amrglassworks.net
http://www.aricketts.etsy.com
12 pages, 26 images, 1.6mb file size, $15.00
This is a step-by-step tutorial for making my Batik glass beads. I've included everything from using frits and making stringer out of them to the final bead. I've included instructions for 2 styles of these beads, Batik and Tie-dye Batik. It shows the prep work and the stages for making frit stringer and applying it to finishing up the final beads with examples of finished beads as well. You do need to have some experience on the torch before trying this technique!

Bead and Jewelry Photography by Kevan Moran Aponte
http://dancingstarbeads.etsy.com
70 pages, 140 diagrams, CD, $19.00
This is a visual tutorial on how to take photos without a bunch of expensive lighting equipment and how to use Photoshop or Elements to make your photos look like the beads you want to sell.

Bead capping 101 by Ronnie Renee
http://www.etsy.com/shop/RonnieRenee?section_id=6611930
$ 12,= 27 pages and 48 photographs
I have had so much fun making these bead caps and have had many requests to do a tutorial. This is a detailed, step by step tutorial on how I create my bead caps 27 pages and 48 photographs show you the methods and tools I use to create them. Included is a list of resources for further ideas that will keep you inspired as you master these skills!
All tools and metals used in this tutorial are readily available in online supply shops.

Bead Ring Tutorial by Jennifer Wood
http://www.etsy.com/view_listing.php...ng_id=36106676
A tutorial on how to make sterling silver rings for your glass beads...

Big Book of Boro Recipe by Cat Ondrey
http://maxnmebeads.etsy.com
2.5mb file size, $25.00
This tutorial contains 42 of my special boro bead recipes. The tutorial contains full color pictures, recipes, ingredients and tips and tricks for every recipe. All of these recipes have been made by me over a period of almost two years. I chose only those recipes that provide consistent results and are easy to follow. I have written this tutorial for those with some basic boro bead and annealing knowledge. This is not a step by step on how to begin working with boro, but a booklet for those that are looking for some fun new recipes and color combinations.

Big Book of Boro Recipe Volume II by Cat Ondrey
http://www.etsy.com/shop.php?user_id=6624960
$ 19,= 2,03mb
This tutorial contains 27 of my custom boro bead recipes. The tutorial contains full color pictures, recipes, ingredients and tips and tricks for every recipe.
I chose only those recipes that provide consistent results and are easy to follow.
I have written this tutorial for those with some basic boro bead and annealing knowledge. This is not a step by step on how to begin working with boro, but a booklet for those that are looking for some fun new recipes and color combinations.

Big Fancy Bead by Patty Lakinsmith
http://PattyLakinsmith.etsy.com
11 pages, 26 images, $16.00
This step-by-step tutorial covers everything you need to know to make a bead like the one in my Etsy avatar. In addition, the following techniques are included:
1. How to use a large lentil press to get beads with nice puckered ends.
2. How to know how much glass to use in your press.
3. How to make a raku twisted cane (twisty) that will pop with color on your bead.
4. How to make a silvered stringer that bursts with silver sparkle.
It is intended for the intermediate glass bead artist who is able to control a large amount of glass on a mandrel, and who is able to make a basic bead. It's possible to make this bead on a Hot Head, but experience with making large beads using this torch is recommended first.

Bird Series by Jennifer Geldard
http://glassgirl.etsy.com
50 images, $17.00
The tutorial shows you step by step how to make the bird shown in the pictures to the right...or the largest bird in the cover group shot.

Birds – Sculptural by Moth / Mary Lockwood
http://www.marylockwood.com
http://marylockwood.etsy.com
Preview pages, video support AND printed version available!
19 pages, 100+ images
PDF version 4.0mb file size, $14.00 / Printed version $25.00
Step-by-step, illustrated instruction to create: Silver Glass Bluebird with variations, Northern Cardinal, Chickadee, Green Bird on a mandrel with pre-made offhand wing attachment w/video support, and Extra wing design. Included with the purchase of this tutorial is a link to a video clip I made of a wing attachment technique. Level: intermediate.

Black Petal by Lydia Muell
http://www.lampworktreasures.com/LampworkTutorials.html
14 pages, 59 images, 4.9mb file size, $15.00
Step-by-step in-depth instructional designed to teach you how to apply my Greek inspired Black Petal Motif to your lampwork beads. Together, we will create a “Black Tie Event” and “Chick Rock” bead.

Bleeding Heart Drop Focal by Moth / Mary Lockwood
http://marylockwood.etsy.com
6 pages, 40 images, 2.0mb file size, $7.00
I explain in complete detail how to make a sculpted Bleeding Heart drop focal and how to insert the bail for hanging.

Blown boro shells and seahorses by Deb Crowley
http://debcrowley.com/gpage5.html
$25.00 for each or $40.00 for both
Part 1 (58 pages, 250+ color photos) & Part 2 (49 pages, 150+ color photos) - We build on skills in Part 1 that we will use in Part 2. If you are not familiar with adding tubing "handles", making great loops or even much about tubing, I suggest you get both parts. If you get part one and want part two later, there is no discount.

Boro on a Concentrator by Pipyr
http://pipyr.etsy.com
http://www.pipyr.com/newsletter.html
69 pages, loads of images, 4.2mb file size, $20.00
I'm excited to present to you a tutorial geared towards the flameworker with a small torch run by concentrators. This entire tutorial is done on a minor hooked up to a single, standard 5 lpm concentrator. I show how to make colors pop in a bead and how to sculpt 5 different little things. This is a fun tutorial that should set you on the track to making great things out of borosilicate glass even with a set up that doesn't pump a ton of heat. Check out the table of contents and pictures of what I demo!

Borosilicate Pendants for Flameworkers Volume I by Chad Trent/Cosmo
http://www.cosmoglassworks.com/store/product.php?productid=16139&cat=3&page=1
$ 32,50
Techniques covered in this book include:
Frit pendants, Implosion pendants, Flower pendants, Drop pendants, Three ways to make loops
And much more...

Borosilicate Pendants for Flameworkers Volume II by Chad Trent/Cosmo
http://www.cosmoglassworks.com/store/product.php?productid=16151&cat=3&page=1 
$ 32,50
Techniques covered in this book include:
* Vortex pendants
* Tube Implosion pendants
* Wig Wag pendants
* Geode pendants
* Three ways to make loops
* And much more...
If you have never made pendants before, it is suggested you start with book #1.
For those of you who own Book #1, the beginning of the book (tools, materials, etc.) is the same. The actual pendant techniques are all new though.

Broken Heart by Shari Slonski
http://etsy-lampwork.blogspot.com/
10 pages, 39 images, 0.9mb file size, $21.50
Step-by-step instructions on how to create a broken heart, including a short instruction for creating a reactive twistie. I started to develop this technique over two years ago and it constantly evolved as I discovered new glass and new skills, allowing me to is create different patterns and texture. I use of mainly ivory and any reactive glass in this tutorial. A companion tutorial on bail attachment is also included.

Buddha Bead by Daniel Caracas of sFd
http://sfdglassbeads.etsy.com
http://sortafloweringdesigns.com
12 pages, 74 images, 2.9mb file size, $10.00
Glass Buddha Head e-book for intermediate glass lampwork artists, a super introduction to hot glass facial sculpting! Use this project as a diving board to jump into the sea of organic glass sculpting, once you have brought a face to life from molten glass, you will want to make another and another, and another. This e-book is for intermediate Glass Lampwork artists who know the basics of hot glass work although if you are a beginner it is a great introduction and teaches you new ways to use glass as your canvas.

Butterfly Fish Murrini by Greg and Deanna Chase
http://ChaseDesigns.etsy.com
35 pages, $15.00
A step-by-step tutorial on how to make a butterfly fish murrine. The tutorial is full of color photos and diagrams and comes with a bonus PDF file of Greg's tips and examples of how to avoid murrine making pitfalls. This tutorial is really for intermediate to advanced flameworkers and is specifically for the butterfly fish. It does include instruction on making an eye in murrine. Though all levels can learn something from the instruction.

Cane, Murrini and Millefiori by Ryan T
http://RyanT.etsy.com
18 pages, 120+ images, available in 1.3, 2.8 and 14.5mb file size, $26.00
This is a set of eight separate and complete tutorials on making murrini, and contains supporting information on many related topics including tools, glass choice, cutting murrini, using murrini, etc... The tutorials are arranged in order of difficulty and progress, from basic shapes all the way to a complex monarch butterfly, including clownfish, blue tangs, two types of butterflies and signature cane. All these tutorials require some experience at the torch.

Canes by Moth / Mary Lockwood
http://marylockwood.etsy.com
21 pages, 100 images
PDF version 3.0mb file size, $15.00 / Printed version $24.88
This tutorial has complete written instructions and step by step images of how to build and use 9 different canes (Striped Vines, Latticino, Pinwheel Twisties, Inside Out Stripes, Tubers, Capped Ribbons, Rainbow Ribbon, Starfish Murrini and Zanfirico Ballerino).

Captured Dragonfly w/ bail instructions by PurpleLily Designs by Joanne Ortiz
http://www.etsy.com/listing/44133561/captured-dragonfly-tutorial-with-bail
$ 16,50; 20 pages; 36 photo’s
This tutorial features the Captured Dragonfly Pendant, as well as, my Style 1 Bail that I have made for my designs and sold as supplies.

Chainmaille by Ellen Black
http://ellenblack.com/catalog.php?category=14
30 pages, 100+ images, $16.00
European Four in One, European Six and One, Box, Full Persian and Japanese Weave

Chaos – Copper Mesh by Sherry Bellamy
http://SherryBellamy.etsy.com
34 pages, 50 images, 2.0mb file size, $18.00
A highly detailed, step-by-step description of how to manipulate copper mesh in your glass beads, creating a fascinating and detailed abstract effect, this tutorial includes lots of instructions covering every potential problem (showing you how to avoid them; and how to solve them!)

Chaos Fume Opal Pendant (boro) DVD by Hagstrom Art Glass
http://hagstromartglass.etsy.com
DVD, $30.00
Borosilicate Bead and Pendant Tubing Tricks Vol II. This DVD tutorial shows you in-depth how to get a virtual rainbow of colors from gold and silver fuming using inside-out
tubing tricks to create the chaos cane. You will also learn how to encase Gilson Opals, as well as method for using silver colors to make amazing intricate loops for your pendants.

Chintz Bead by Anne Ricketts
http://www.amrglassworks.net
14 pages, 32 images, 1.0mb file size, $15.00
This is a step-by-step tutorial for making my Chintz glass beads. I've included everything from where I get my inspiration to putting on the final touches for making a chintz bead. This tutorial shows the prep work and the stages for building your chintz beads with examples of finshed beads as well. You do need to have some experience on the torch before trying this technique!
« Last Edit: April 27, 2010, 06:54:24 AM by Maria Louisa » Logged

Maria Louisa
Maria Louisa
Forum Member
***
Posts: 115


WWW
« Reply #2 on: April 26, 2010, 09:16:30 AM »

Classic Garden Trio by Lydia Muell
http://www.lampworktreasures.com/LampworkTutorials.html
16 pages, 64 images, 1.3mb file size, $15.00
In this tutorial we will be creating the beads, “Classical Garden” focal and pair of drop. The level for this tutorial is advanced. Proper execution of this design will be better achieved if you have practiced the "Encased Floral Panel" technique, as this tutorial is an extension of it and is not meant to supersede it.

Color Twist Necklace by Tease Beads
http://www.etsy.com/listing/28128708/color-twist-necklace-tutorial-tease
$ 12,50
Have you seen my color twist necklaces and wanted to make your own? I now offer a tutorial teaching how to make this beautiful necklace! This tutorial teaches my modified version of what I have seen called a netted tube, or Russian spiral. This fully-detailed tutorial includes 37 large, full color photographs and directions for how to condition your thread, stitch the necklace, and even make my handmade ball-and-loop clasp.
As an added bonus, I give details on how to add a wire-wrapped focal bead, such as my handmade lampwork beads. To do this, you should be comfortable with basic wire-wrapping techniques, such as forming a spiral in wire using jewelry pliers.
On the right are some sample pictures from the tutorial. There are no special tools needed for the necklace, just beads, needle, beeswax, and thread. For the optional pendant portion, you will need silver wire or long headpins, a focal bead, and round-nosed & flat-nosed jewelry pliers.

Cosmos Wire Wrapping by Sylvia White
11 pages

Crazy for Daisies by Laurie Donnette
http://everafterartistry.etsy.com
24 pages, 50 images, 1.9mb file size, $13.01
Step by Step tutorial of making Two different Daisy type beads – A raised round daisy, and a full bloomed daisy! This is my Fourth tutorial made in this sculptural flower series, each with its unique techniques!

Creating a Shipwreck Bead by Sherry Bellamy
http://www.etsy.com/listing/41539481/tutorial-creating-a-shipwreck-bead
$ 24,=
You will receive a highly detailed and lavishly photographed tutorial describing in great detail the techniques that I use to create these watery beauties. I'll take you along as I make one of these beads, giving detailed explanations for each step. (The bead in the third photo is the actual tutorial bead that we'll create.)
You will also receive two additional smaller tutorials, "Making Tiny Implosions in Soft Glass", and "Hollow Illusion" cane. If you've never created an implosion with soft glass, I'll show you how!
These tutorials are all based on 104 COE glass, and include information on the glass colors, tools, and materials etc. that I use.
They are intended for the soft glass artist who has some experience on the torch, but one of the great features of this tutorial is that it's sort of a buffet of techniques; you can decide which ones to use...or you can cram them all into a single (possibly crowded!) bead!
All techniques are done with a mixed fuel type torch.

Cupcake Beads by Beads by Laura
http://www.beadsbylaura.co.uk/BBLDownloads.htm
£5.99
This ten page tutorial shows you how to make a basic Cupcake bead and how to add a cherry to the top. I don’t cover the decorative elements in this tutorial. Decorating your cupcakes is up to you - you can add sprinkles in the form of raised dots, flowers, hearts or whatever else takes your fancy. This tutorial just gives you the low-down on how to make a basic cupcake shape.
For this tutorial you will need some glass in your chosen colours, a graphite paddle or marver and a razor tool. I use enamel for my Cupcake beads but this is optional and not imperative.
You will need to have good heat control to make the beads in this tutorial and as such I would not recommend it to an absolutely new beginner beadmaker.

Daisy Bead Garden Bracelet by Nicole Valentine / Nicker
http://NValentineStudio.etsy.com
10 pages, $17.00
This tutorial will show you how to make daisy style beads and also assemble them into stunning garden bracelets. Early on in my beadkmaking days I wanted a large signature style piece that was also comfortable to wear. The garden bracelet was born! Geared towards a intermediate beadmaker, but beginners should be able to handle this style of bead as well.
This tutorial is designed for the intermediate/advanced lampwork artist, however beginners will find this information useful in helping to enhance their skills at the torch as well.

Desert Moon by Daniel Caracas of sFd
http://www.artfire.com/modules.php?name=Shop&op=listing&product_id=414398
$ 5,=; 9 pages, 35 photo’s
Create a Landscape with Elegance and Drama! The Crescent Moon in a Starry Sky overlooks a Desert with Depth and Visual Texture.
Desert Bead e-book Tutorial- Learn to make a Focal Press Bead, or Tab Bead, using unique Glass and Metal Reactions, with cool bonus Techniques~
This is a Beginning to Intermediate Tutorial in which you will use Silver Foil, Silvered Ivory, Silver Wire, and Fun Design Methods to achieve a visually stimulating and imaginative Bead-Scape.
Step-by-step easy to follow instructions on how to create a Desert Moon Bead out of Soda Lime Glass.

Dragon Born of Glass and Fire by Roger Child
http://Glassroger.etsy.com
24 pages, 97 images, 3.1mb file size, $20.00
Dragons are magical creatures and come in all shapes and sizes. This tutorial will teach you how to make the eyes of a dragon as well as the head and belly of a dragon, that will be made into a dragon head pendant. This tutorial is filled with color photographs and instructions detailing every step of the process. It will also help beginner and advanced lampworkers learn the process of off mandrel borosilicate lampworking. Please see companion tutorial: Dragon Wings – How to Make Dragons Take Flight

Dragonfly by Kerri Fuhr
http://www.etsy.com/listing/43503255/kerribeads-lampwork-dragonfly-focal-bead
$ 22,=; 24 pages, 67 photo’s
This is a detailed, step by step tutorial on how I create my dragonfly focal beads! It illustrates in 57 steps the methods I use to create them. Included is a gallery of beads as well as a list of resources for further design ideas that will keep you inspired on your own creative path as you master these skills!
All glass used in this tutorial is 104 COE and is readily available in all glass supply shops. I have used regular Moretti/Effetre opaque colors in this tutorial however other glass colors can also easily be substituted for your own preference (such as silvered glass) to achieve a variety of colors and effects!

Dragonfly Pendant by Julie Sigmund/jewlie beads
http://www.etsy.com/listing/44151089/tutorial-for-dragonfly-pendant-buy-one
$ 12,= 22 pages 41 steps
In this step by step tutorial, I will show you how to make my wire wrapped dragonfly pendant. Using a torch is optional. The dragonfly can be made with or without any fusing.

Dragon loco Style by Loco
http://www.lampworketc.com/ppc/showcat.php?cat=7
56 pages, 140+ images, 1.0mb file size, $19.69
So you want to enter the world of mythical magical Dragons. It’s time to let your imagination run wild, to play hard at having fun! Stretch your limits and explore your inner child. Come on admit it everyone loves toys. With this tutorial you can make your own Dragons in glass and remember it’s never too late to have a happy childhood! In this tutorial I cover the birthing of a dragon loco style using 104 COE glass. Over 140 photographs showing each step of the journey, along with detailed descriptions of each step. All of this contained in 56 pages. This is an intermediate level bead making tutorial.

Dragon Wing – How to Make Dragons Take Flight by Roger / Glassroger
http://Glassroger.etsy.com
8 pages, 23 images, xmb file size, $10.00
Dragons come in many shapes and sizes and their wings vary from one species to another. This lampworking tutorial will help beginner and advanced lampworkers alike, learn how to make majestic looking dragon wings. This is just one way to make a wing that suits my dragons and may also be used to add variety to other mythical creatures, such as fairies, pixies or goblins. This tutorial is demonstrated with borosilicate glass, but the techniques learned here can also be applied to soft glass. Please see companion tutorial: Dragons Born of Glass and Fire.

Electroformed Glass Cabochon Pendant by Kim V
http://KimVGlass.etsy.com
36 pages, 74 images, 2.3mb file size, $20.00
This tutorial on making electroformed glass cabochon pendants includes how to make an off-mandrel soft glass heart-shaped cabochon, an off-mandrel borosilicate round cabochon, as well as using the process of electroforming to create a pendant. Please note, this is not a step by step tutorial on starting out and using an electroforming set-up for the first time. It is based on one having at least some previous electroforming experience.

Electroforming by Tink
http://blackswampglassworks.com/eform.htm
14 pages, $10.00

Elegant Chambers by Daniel Caracas of sFd
http://sfdglassbeads.etsy.com
http://sortafloweringdesigns.com
15 pages, 56 images, 2.6mb file size, $5.00
Learn to make a Focal Press Bead, or Round/Barrel Bead using unique Glass and Metal Reactions, and Special encasing Techniques. A Beginning to Intermediate Tutorial – you will use Silver Foil, Hand-Pulled Goldstone, and Raku, along with other Reichenbach and Effetre reactives to achieve gorgeous Patterned effects AND THEN add Layers of Crystal Clear in a way that creates intricate looking horizontal Chambers throughout your Bead. cool!

Encased Dichroic Floral by Cynthia Tilker
http://www.etsy.com/listing/42195613/encased-dichroic-floral-bead-tutorial
$ 24,= 35 pages & 75 pictures, 1,9mb
A tutorial on Encased Florals with a Dichroic background, and surface decor.
With lots of information about how I encase floral beads and tons of tips for making an encased bead.
This is a complete and concise instructional tool that will show you in detail, how to build an Encased Dichroic Floral Bead from pulling cane, to all of the complete steps and decoration needed for this style of bead.
Materials and tools needed are listed.

Encased Rose by Vanessa Cabrera / veeanca
http://veeanca.etsy.com
22 pages, 74 images, 1.51mb files size, $18.00
This tutorial is made up of three parts and will show you how to create a fully encased rose bead using COE 104 glass, including the canes and twisties needed to create the bead. It assumes knowledge of pulling stringers, making twisties, and encasing. Each purchase will receive 2 versions of the tutorial, 1 full version (the pretty one!) and 1 printer friendly version to help save on ink.

Encased Floral Panel by Lydia Muell
http://www.lampworktreasures.com/floralpaneltut.html
13 pages, 1.44mb files size, $22.00
In this tutorial we will be creating the cover bead, “Enchanted Hydrangea”. This comprehensive tutorial explains the "Encased Floral Panel" technique in thorough detail. Before moving on to the more complex focal tutorials, I highly suggest trying this one first. Due to the complexity of the design, it may be a bit difficult for the novice bead maker. Proper execution of this design will be better achieved if you already have a bit of experience in the following areas: pulling stringer, making a round bead, encasing, using silver foil, making goldstone stringer, and creating surface or encased florals.

Encased Floral by Kimberly Affleck
http://www.coloraddiction.com/kims.html
200+ images, 50 pages, three separate files at 5.6mb, 4.7mb, and 9.2mb in file size, $30.00
In this tutorial you will learn to pull an encased goldstone stringer, make an easy twisted vine cane and using those elements, build a deeply encased floral bead. At the end of the e-book, I have included a chart of some of my favorite color combinations for encased florals. The tutorial is aimed at intermediate beadmakers.

Encased Floral by Kandice Seeber
http://www.coloraddiction.com/encasing.html
26 pages, 3.0mb file size, $17.00
The tutorial is geared toward the novice beadmaker. In this tutorial, you will learn to make a basic encased flower bead, a more ornate encased floral bead, simple vine stringer, and more. There's also an in depth comparison of different kinds of clear glass.

Encasing Boot Camp by Mary Lockwood
http://www.etsy.com/listing/45181406...torial-by-mary
Click here for supplies list and first 2 pages.
23 pages, 100 full color images. 7 Techniques and countless tips. Trouble shooter.
Introductory price on Etsy- $15 until May 1st!
Based on my weekend workshop, this tutorial is over 7MB of knuckle-down encasing know-how.
This is my biggest tutorial so far!

Encasing Silver Glass & Encasing Glass Beads by Charmaine Jackson
http://www.etsy.com/listing/28127553/encasing-silver-glass-and-encasing-glass
$ 18,=
One thing I've found in speaking to other beadmakers is that people don't like to encase, because either it ends up making the bead really huge, it distorts the pattern underneath, or they end up with really big, distracting bubbles.
Since I hate bubbles with a passion, I have a combination method that allows you to thinly encase larger beads (1-2 inches in length) without introducing bubbles or smears at the junction of the clear layers.
I didn't realize I was doing anything all that interesting until a friend was watching me encase and said she'd never seen anyone encase like I did, nor did she get the smooth, thin layers that I can get using my method. If you'll peruse my newest etsy bead additions, you'll see beads that will make you say, "That's encased?". They're slim and gorgeous.
In the interest of helping you create more beautiful beads, I offer you this 13 page encasing tutorial. This etsy item is for a .pdf file which I will email to you to the email address you provide at checkout. the file does not transfer automatically, I have to actually send it to you, so it may take up to 6 hours before you receive it.
To my knowledge, I have never been exposed to this method of encasing; I took a technique used for small beads and applied it on my larger beads, and was able to get consistent results by doing so. There are only so many ways to encase a bead, and it is possible (and likely) that someone else has also thought of and uses this method, which is why I do not claim to have invented it (implying that no one else would have thought of it, or that I'd done something so innovative that no one had ever tried it in their own quest to encase better.)
I just know that a lot of people have trouble with encasing, and this method works to get rid of bubbles and provides a thin, smooth encasement layer.

Excellent Enamel Adventure by JC Herrell and Margaret Zinser
http://www.jcherrell.com/Tutorials.htm
http://JCHerrellGlass.etsy.com
66 pages total, 7 pdfs, $37.00
This package of seven tutorials includes hundreds of photographs and diagrams designed to thrill and entice you into the wonderful world of enamels! We focus on color fades, texture effects, coverage, application and all the special needs of enamels in addition to some bead basics like shaping, and bonuses like stringer work, among others! The package includes: Enamel properties and safety (6 pages, 597 KB file size), MZ’s rolled spacers (8 pages, 14 steps with 22 photos, 2.37 MB), JC’s sifted spacers (8 pages, 8 steps with 13 photographs, 3.24 MB), MZ’s aventurine enamel bead (12 pages, 28 steps with 32 photos, 3.07 MB), JC’s faded draft bead (13 pages, 28 steps with 37 photos, 5.98 MB), MZ’s flower pick up (12 pages, 24 steps with 29 photos, 8 photos 13.03 MB), and JC’s speckled data bead (12 pages, 23 steps with 27 photos, 4.87 MB)

Eye Cane by Pipyr
http://pipyr.etsy.com
http://www.pipyr.com/newsletter.html
52 pages, 3.6mb files size, $20.00
Not only will you learn how I make my boro eye cane and TWO ways of making a soft glass eye cane with similar effects, but you will also learn how to use it once you've made it! You do not need anything special to use this tutorial in the way of glass, torch, or tools. You can even make soft glass eye cane on a hot head! There is a section that shows how to use silver glass in eye cane, but there is also a section using regular run-of-the-mill moretti glass to make an equally beautiful eye.

Fancy Fans Wire-Wrapped Earrings by Julie Sigmund/jewlie beads
http://JewlieBeads.etsy.com
26 pages, $8.00
This is a step by step tutorial for my Fancy Fan earrings. For more information, please visit Etsy store link.

Fantasy Butterfly by Carla
http://www.etsy.com/shop.php?user_id=5172344
20 pages, 38 images, 1.4mb, $14.00
special discount of $20 for both Wild Flower and Fantasy Butterfly Tutorials together
This is a TUTORIAL for my popular Fantasy Butterfly. I have been asked several times to teach how to do this popular flower design, so I thought I would go ahead and put out a tutorial for it! This tutorial is mainly for the intermediate/advanced lampworker, but if you are just starting out you will also get a lot out of it. If you are a Hothead user, you CAN use this tutorial!

Floating Heart Earrings by Julie Sigmund/jewlie beads
http://www.etsy.com/listing/45001869/tutorial-for-floating-heart-earrings
$ 10,= 19 pages 32 steps 66 photo’s
In this step by step tutorial I will show you how to make my "Floating Heart Earrings". A torch is required for fusing the copper or .999 fine silver wire.

Footprints in the Sand, plus seashell and a secret by Laurie Donnette
http://everafterartistry.etsy.com
1.6mb file size, $14.00
Step by step on how to construct a lampwork Footprints in the sand bead, how to sculpt a lovely conch like Shell, and a little secret!!! This tutorial uses completely different sculpting techniques than my previous tutorials.
This is geared towards the intermediate lampworker, However I do believe a beginer can also learn from all of my tutorials.

Glass Color Families: Brown by Kandice Seeber
http://www.lampworketc.com/ppc/showcat.php?cat=7
26 pages, 5.0mb file size, $15.00
This tutorial is on the different shades of brown in the 104 COE color line. This booklet is great beginners and novices, but has useful information for the intermediate beadmaker who is looking for information on this color family. You'll see some techniques in the tutorial as well. Skills useful to use this tutorial are:
Pulling one-color stringer
Making a round base bead
Striking color
Dexterity with small tools (like the tungsten curved pick)
Heat and flame control

Glass Color Families: Pinks by Kandice Seeber
http://www.coloraddiction.com/pinks.html
$ 17,= 30 pages
Tutorial on the different shades of pink in the 104 COE color line, and includes some techniques as well. Covered in the tutorial are various pinks from Effetre, Vetrofond and CiM. This booklet is great beginners and novices, but has useful information for the intermediate beadmaker who is looking for information on this color family. I recommend a duel fuel torch such as a Minor Burner. Skills useful in this tutorial are:
Pulling one-color stringer
Pulling encased stringer
Making a round base bead
Placing dots on a round bead
Heat and flame control
Encasing & layering glass

Gold Champagne & Sparkle Balls by Christina Stofmeel
http://www.etsy.com/listing/31703699/gold-champagne-and-sparkle-balls-e-book
35 pages, 81 photo’s, 4,31mb
What will you learn in this E-book?
• Gold Champagne Balls
• Sparkle Balls
• How to apply hair thin stringers
• How to use murrini
• BONUS: How to apply Sakura Flower Murrini
« Last Edit: April 27, 2010, 06:56:03 AM by Maria Louisa » Logged

Maria Louisa
Maria Louisa
Forum Member
***
Posts: 115


WWW
« Reply #3 on: April 26, 2010, 09:17:55 AM »

Gold Fume Flower Implosion (boro) DVD by Hagstrom Art Glass
http://hagstromartglass.etsy.com
DVD, $30.00
Borosilicate Bead and Pendant Tubing Vol I. This DVD tutorial shows you the basic techniques to create a wide variety of pendants – fume precious metals, use of 12.5mm boro tubes, pendant making, bubble consruction, etc. etc.

11 Things to Do with Goldstone by Sarah Hornik
http://www.glassbysarah.com/ebooks/goldstone/
71 pages, 230 images, 10mb filr size, $29.00
This e-book is all about the wonderful sparkly glass that comes straight from Murano. Learn all about it, how to work with it, incorporate it into your glass beads, and more!
The book is divided into two sections. In the first part, you will find loads of information about goldstone and tips on how to work with it. The second part is the tutorial section, which includes 11 step-by-step tutorials, ranging in level from beginner to advanced. The second section also includes several "Ideas and Inspiration" pages, loaded with extra suggestions on what to do with goldstone!
1. Floating Sparkle Bead
2. Swirled Sparkle Bead
3. Goldstone Frit Stringer
4. Goldstone Frit Twistie
5. Silvered Goldstone Frit Bead
6. Unencased Goldstone Stringer
7. Encased Goldstone Stringer
8. Egyptian Artifact Bead
9. Twisted Cane with Goldstone
10. Murrini with Goldstone
11. Sparkly Ribbon Bead

Goofy Mouth Vessel by CloudEleven
http://www.etsy.com/listing/35122032/turorial-goofy-mouth-vessel-lampwork
$ 18,=; 16 pages, 58 photo’s, 2,15mb
While this tutorial is geared toward those who have had some experience with blowing hollow vessels, I have also included basic blowing instructions for the hollow newbie. If you have not blown hollow vessels before, you may want to practice with a few basic
bubbles before continuing on.
Hopefully, you will attain better heat control along with the skills to make a goofy mouth vessel.
This tutorial requires nothing more than basic lampwork tools, 1/4" hollow mandrel and 104 COE glass.

Halloween Beads by Lori Peterson
http://loribeads.etsy.com
21 pages, 30 images, 2.0mb file size, $15.00
A step-by-step tutorial for making some of my Halloween beads. Learn how to make bats, pumpkins and skulls for lots of fun this Halloween! You need to have some lampworking experience before making these beads. If you can make a round bead and have some heat control mastered, you can make these beads, though.

Harmonic Hearts by Lydia Muell
http://www.lampworktreasures.com/har...stutorial.html and here's a link to the PDF preview: http://ashtonjewels.com/tutorials/ha...tutpreview.pdf
$ 25,= 41 pages, 192 photos and the PDF size is 3.5KB
It is actually a collection of three different heart designs, Sunset Opal, Plutonic Love and Moonlight Waltz. This tutorial does require the purchase of several silvered glasses, all of which are available through most lampwork supply distributors. No special tools are required.

Harvest Time Fruits and Harvest Time Veggies by Anne Rickets
http://www.amrglassworks.net/Fruits-and-Veggies-tutorial.html
$ 15,= each
These tutorials are a step-by-step tutorial for making my sculptural fruits and vegetable beads. I've included instructions for making 3 different flat leaf canes and  making stringer out of them. I've included instructions for 5 fruits and 5 veggies.
The fruit tutorial is 15 pages with 33 pictures showing the prep work and the stages for making leaf cane stringer and enamel stringer and applying it to finishing up the final beads with examples of finshed beads as well.
The veggie tutorial is 17 pages with 38 pictures showing the prep work and the stages for making leaf cane stringer and applying it to finishing up the final beads with examples of finshed beads as well.
You do need to have some experience on the torch before trying this technique!
These will be sent to you via email as a .pdf file,
Fruit tut is 714KB in size and Veggie tut is 877KB.
You will need Adobe Reader (free to download off the internet I'm told) to open the file.

Honeybee Tutorial by Kerri Fuhr
http://kerribeads.etsy.com
20 pages, 45 images, 2.1mb file size, $22.00
This is a fun and detailed tutorial that goes through each little step in the creation of one of my honeybee beads. There is a mini-version of this tutorial available in the Winter 2009 issue of The Flow Magazine. This downloadable pdf is the full, expanded version. Also included are hot tips and a bonus gallery of bee beads for further inspiration.

House of Vettii Focal Bead (and Classic Urn too!) by Lydia Muell
http://www.lampworktreasures.com/LampworkTutorials.html
18 pages, 68 images, 1.3mb file size, $22.00
This tutorial is an extension of the "Encased Floral Panel" tutorial and is therefore not meant to supersede it. If you haven't tried the Encased Floral Panel tutorial yet, you might want to do that before trying this one. Included in this publication are two focal bead tutorials, "House of Vettii" and "Classical Urn", as well as a section for building the Black and Goldstone Twisted cane and setting CZ's. All of the glasses used are 104 COE and two of the specific glasses are silvered. The level for this tutorial is advanced.

How to Build Your Own Electroforming Kit by Wendy Inman
http://wendyki.etsy.com
17 pages, $12.95
This tutorial will show you step by step how to build your own kit for around 150.00. It may be less if you use your phone and find better deals locally. It lists suppliers and websites as well as basic set up and directions on electroforming.

Icicles Tutorial by Shawn T
http://www.setinglass.net/category_11/Tutorials.htm
21pages, 25 images, 0.5mb file size, $7.99
This tutorial is written for borosilicate glass and has been tested by soft glass workers who have never touched boro before. They had no problem following it and had great results working in boro.

Icicles and Blown Christmas Ornaments by Candice King-Palgut / patienthand
http://www.lampworketc.com/forums/sh...d.php?t=111064
78 pages, 183 images, 3.0mb file size, $25.00
There are 5 styles of icicles. Three are made with rods and one is blown, and one is made with scrap from blown ornaments. There are four styles of blown ornaments as well as a section on pulling points and straightening them. There is also a section on materials and sources. This is suitable for either soft glass or Boro. The tutorial is arranged to bring a new glassworker though a series of progressive skills that build towards the more complicated ornaments and is suited for the beginner through advanced flameworker. This is a tutorial you can grow with.

Inside-Out Beads by Chad Trent / Cosmo
http://www.cosmoglassworks.com/store/home.php
14 pages, 36 images, $15.00 pdf, $20.00 printed version
This tutorial will show you how to make inside out beads from borosilicate glass.

Island Waves Bead by Daniel Caracas of sFd
http://sfdglassbeads.etsy.com
http://sortafloweringdesigns.com
10 pages, 38 images, 1.5mb file size, $5.00
Make Waves! island Waves e-book Tutorial, Learn to make your Ocean Sea Scapes come alive with twisting waves and sea foam~ This is a Beginning Tutorial that is a lot of fun, using enamel and silver foil to enhance and bring to life one of natures miracles on a glass bead. Step by step and easy to follow instructions on how to make a gorgeous glass Sea Scape Lentil out of Soda Lime Glass.

Ivory Barrel – A Quick Lesson in Shaping by Kimberly Affleck
http://www.coloraddiction.com/ivory1.html
21 pages, 6.0mb file size, $15.00
This tutorial is on how to shape a large barrel bead with no tools. The technique covered in the tutorial is one I use for many of my beads. The tutorial is suitable for advanced beginners through intermediate bead makers.

Jellyfish Seascapes by Moth / Mary Lockwood
http://www.marylockwood.com
Printed version (with preview pages!)
http://www.lulu.com/content/3143288
21 pages, 100+ images
PDF version 2.0mb file size, $18.00 / Printed version $27.00
I explain in complete detail how to make a 3-dimensional jellyfish aquarium focal. From prep work and pulling canes to creating the creatures themselves I take you step by step through the process. Followed by a troubleshooting segment and a 'glossary.'

Jewel Cap by Lydia Muell
http://www.lampworktreasures.com/jeweledcaptut.html
7 pages, 29 images, less than 1.0mb file size, $7.00
This tutorial shows how to make an ornate 22-24mm jeweled bead cap, using basket weaving and basic coiling techniques with 20-ga wire.

Keeper of the Thicket Sculptural Bead by Cynthia Tilker
http://www.glassactcc.etsy.com
29 pages, 65 images, less than 2.0mb file size, $24.00
This is a complete and concise instructional tool that will show you in detail, how to build a "Keeper" bead from pulling cane, to all of the facial features and decoration.

Kumihimo Beaded Bracelet by Jeanette Savina
http://jsavina.etsy.com
25 pages, 11mb file size via email or CD for PC only (Mac compatible CD will be available soon), $15.00, bound book $17.50
Here is a comprehensive, step by step, fully illustrated tutorial. 25 pages of instructions, images, and information that will teach you how to make a lovely beaded weaved bracelet using the popular Japanese Kumihimo disk.

Lampwork Citrus Slice Murrini’s by the Glasszone
http://www.etsy.com/listing/41496536/lampwork-citrus-slice-murrini-tutorial
$ 16,50
This detailed Tutorial will teach you how to create and apply realistic-looking Citrus Slice Murrini to your beads and glass creations! Nine (9) pages and step-by-step photos guide you through the process, along with many tips and tool "how to's" (and a few "don'ts", too)!!!
In addition, this "Kit" version will include (via First Class Mail) pre-made Murrini Slices (COE 104) as follows:
* 4 "Orange" Murrini
* 4 "Lemon" Murrini
* 5 "Lime" Murrini

Lampwork Etc. Tutorials and Tips Book compiled by Karen Hardy
http://www.lulu.com/content/2560502
Paperback, 62 pages, $13.83
How to Make a Cased Horizontal
Holed Surface Decorated Floral Heart by Amy Trescott
Baby Chicks by Sara Hoyt
Brass Shim Stamps by Bobby Pedersen
Flower Petal Tutorial by Bobby Pedersen
Making Rose Murrini by Sara Hoyt
Small Off Mandrel Leaf Tutorial by Bobby Pedersen
How to Make a Froggie by Wizzie Brown
Frosty Tutorial by Melodie Triche
Goddess Bead Tutorial by Sarah J Schalken
Anne’s Homespun Plaids by Anne Ricketts
Mini Flip Flops tutorial by Karen Hardy
Off mandrel Dolphin Tutorial by Mike Marsh
Pumpkin Tutorial by Brandie Rosenberry
Seahorse Tutorial by Kim Hart
Silver Foil and Wire Lentil Tutorial by Mary Beth
Sadie’s Hollow Heart Tutorial by Sadie Cuming
Bead Gallery

LavenderCreek Goddess Bead by Teresa Laliberte
http://lavendercreek.etsy.com
35 pages, 26 images, 1.7mb file size, $18.00
This is an in-depth Introduction into the Art of Sculpting with Soft Glass (on a mandrel). It begins with a look at the basics of sculpting; the key elements, how they work and why they are important. Followed by a brief look at my own personal "sculpting philosophy." Using my Willendorf style goddess as our project bead, I take you step by step through each phase of her construction. I have added additional notes throughout the tutorial including helpful tips and more in-depth information on certain techniques. The techniques you will learn in this tutorial are not just specific to making this bead, but will serve you well no matter what type of sculpting/glasswork you choose to do.

Luxurious Linear Drop by Purple Lily Designs by Joanne Ortiz
http://www.etsy.com/listing/16909805/luxurious-linear-drop-tutorial
$ 8,= 10 pages, 14 photo’s
Luxurious linear drop pendant & earrings tutorial

Make Your Own Button Mandrels!
http://www.jorebeka.com/mandrelsystem.html
$ 15,= 35 pages Step-by-step instructions, over 100 illustrations, plus a 6 page introduction to successful button making.
I've finally written a tutorial describing my Button Maker Mandrel System, and it is ready for purchase!
This tutorial teaches you how to make a very versatile Button Mandrel for 2-hole, 3-hole or 4-hole buttons in sizes from 1/2" to 3-1/2" diameter (12 variations in all).
Anybody can make this system. Guaranteed!
No special tools or skills are required, and the mandrels are constructed from very readily available materials. This mandrel holder system is so simple to construct, if you buy the tutorial and honestly don't think you can do it yourself, I will make one for you and ship it to you for a very minimal cost (details in the resource section of the tut).

Making Armadillo Beads by Anouk Jasperse
http://www.etsy.com/listing/43164507/making-armadillo-beads-working-with
$ 19,99; > 200 pictures, 51 pages
In this step-to-step tutorial I will work with the newest silver glass by Double Helix (which is Clio) and I will also show you how to use Ekho for this design as well!
And not only Armadillo beads, there are 2 extra "mini" tutorials in this E-tutorial as well! First is a tutorial about silver glass twisties. I will share my favorite receipes and show you how I make and pull them. Second, there is a guide for making a "simple" flower murrini.

Making Encased Stripe Beads by Kandice Seeber
http://www.coloraddiction.com/stripes.html
$ 14,= 17 pages 1,5mb
Tutorial on how to make encased stripe beads. The tutorial is geared toward the novice beadmaker. In this tutorial, you will learn to make a basic encased stripe bead, learn some variations on the design and also some information on glass types and colors. To be successful with this tutorial, you should have the following skills:
Pulling stringer
Making a round base bead
Stacking dots
Dexterity with small tools (like a curved dental pick)
Be comfortable with heat and gravity


Making of A Goddess by Kevan Aponte
http://dancingstarbeads.etsy.com
40 pages, 90 images, both pdf and video, $19.00
The tutorial is a CD with a PDF written tutorial and a 13 minute movie in WMV file format. The written portion explains step by step the exact process as shown in the video on how to make a goddess bead.

Making Hummingbirds with Green Aventurine Stringer by Jeannie Cox
http://www.jeansbeads.com/sales.htm
$ 9,95 10 pages > 60 photos
I recently posted my new Hummingbird tutorial for sale, made with green aventurine stringer.
2 Tutorials in 1. First, there's the flattened green aventurine stringer, then making the hummingbird.

Making Mandala Beads by Sarah Hornik
http://www.glassbysarah.com/ebooks/mandala/
87 pages, 250+ images, 12.5mb, $24.00
Making Mandala Beads is an E-Book with six tutorials, three for different types of cane and three for elaborate Mandala disk beads: Spiral Murrini, Wig-Wag Cane, Ribbon Cane, Wig-Wag Mandala Bead, Ribbon Cane Mandala Bead, and Spiral Murrini Mandala Bead. The book also includes information and tips and tricks about working with Bullseye glass, as well as a collection of my favorite color combinations. My Mandala-inspired beads are very intricate, layered disk beads. Incorporating different types of complex cane, they are great for improving your heat control, dot placement, gravity control and other technical abilities, providing you with lots of new and exciting possibilities!
The techniques in the E-book are demonstrated using Bullseye glass. You can definitely accomplish the same techniques in COE-104 glass, but I find that working with Bullseye makes life a bit easier. Besides, the colors of the Bullseye palette are just fantastic - and you know how much I love color! Since Bullseye may be unfamiliar to some readers, the E-book includes lots of tips and tricks for working with this glass, ideas to spark your imagination and a collection of my favorite Bullseye color combinations.
The first part of the book is dedicated to general information about Bullseye glass and its working properties. Then comes the tutorial section, which includes 6 step-by-step tutorials - 3 cane tutorials and 3 focal disk bead tutorials. At the end of the book, you will find the “Ideas and Inspiration” section - these pages contain variations on the techniques and ideas to spark your creativity.
List of Tutorials:
1.   Spiral Murrini
2.   Wig-Wag Cane
3.   Ribbon Cane
4.   Wig-Wag Mandala Bead
5.   Ribbon Cane Mandala Bead
6.   Spiral Murrini Mandala Bead

Making of A Goddess by Kevan Aponte
http://dancingstarbeads.etsy.com
40 pages, 90 images, both pdf and video, $19.00
The tutorial is a CD with a PDF written tutorial and a 13 minute movie in WMV file format. The written portion explains step by step the exact process as shown in the video on how to make a goddess bead.

Making a Shank Button using Jelveh Designs Key Mandrel tutorial by Anne Rickets
http://www.amrglassworks.net/Button-Tutorial.html
$ 12,= 13 pages, 30 photo’s, 3,08mb

Making Silver Glass Sing by Anouk Jasperse / Troll Lover
http://trolllover.etsy.com
17 pages, 3.8mb file size, $18.00
In this tutorial focuses on reducing silver glass – how to encase them, while keeping the shine & color. I will share my secrets on how I work them and which base colors will make the silver glass pop. I also included some extra information about reducing and more! I will show you how to make 3 beads: my (Psyche) crunchies, a crunch bead with Triton & dichroic stringer and how you can use the newest color by Double Helix, Aurae.

Making Silver Glass Sing Volume 2 – Working with Striking Colors
  by Anouk Jasperse / Troll Lover
http://www.etsy.com/listing/37487072/making-silver-glass-sing-volume-2
$ 25,= 72 pages, > 140 pictures, 7mb
 In my newest E-tutorial I will show you how I work with 4 different Striking Silver Glass colors:
• Ekho (Double Helix)
• Khaos or Luna2 (Double Helix)
• Green Dalai (Trautman Art Glass, known as TAG)
• Transcendental or Dalai Lama (TAG)
I'm showing you how to make PINK beads with Ekho! I also show you how I make my Caterpillar beads. All my secrets will be revealed in this tutorial!
This tutorial is BIG! I added more than 140 pictures, including end pics of the beads and some inspiration. I also added pictures of some test beads I made with different base colors under the striking colors.
In here, you will find a lot of tips on which colors work well and how to get those difficult colors to strike. If you know my work, you'll know that I love to encase my beads. In this tutorial, I will be showing how I encase my striking silver glass.
« Last Edit: April 27, 2010, 08:09:28 AM by Maria Louisa » Logged

Maria Louisa
Maria Louisa
Forum Member
***
Posts: 115


WWW
« Reply #4 on: April 26, 2010, 09:18:37 AM »

Making Simple Raised Flower Beads by Kandice Seeber
http://www.coloraddiction.com/raised.html
$ 13,= 17 pages
How to make simple raised floral beads. The tutorial is geared toward the novice beadmaker. In this tutorial, you will learn to make a basic three-petal flower bead, a five-petal flower bead and also some variations on the design. To be successful with this tutorial, you should have the following skills:
Pulling stringer
Making a round base bead
Stacking dots
Dexterity with small tools (like the tungsten curved pick)
Be comfortable with heat and gravity

Making Wool Bead by Mary MacVoy / MerryFool
http://WoolTwoGo.etsy.com
10 pages, $15.00
This tutorial takes you through the steps that I use when I make my felted wool beads! Dry Felting and Embellishment. This PDF file with 10 pages of photos, illustrations,detailed instructions, and a gallery will get you well on your way to making your own felted wool "wearable art!"

Marble Techniques for Flameworkers by Cosmo
http://www.cosmoglassworks.com/store/product.php?productid=16137&cat=3&page=1
$ 32,50
My new marble making book is now available.
Techniques covered in this book include:
* Basic marble shaping
* Using punties
* Marble designs including - corkscrew, galaxy, implosion, flower, vortex, and more
* Surface design and pattern work
* Annealing

Monte Carlo by Daniel Caracas Sfd
http://www.artfire.com/modules.php?name=Shop&op=listing&product_id=414401
$ 5,=; 10 pages & 50 photos
Create an Elegant Richly Decorated Press Shaped Monte Carlo Bead!
This is an beginning to intermediate Glass bead tutorial that assumes you know the basics of hot glass work and how to use a press tool to achieve a uniformly shaped bead. The design looks equally stunning on a Button Shape although this tutorial shows the design being created on a Square Nugget Shape.
Learn to make a Focal Press Bead, or Organic Tab Bead, using unique Glass and Metal Reactions, with cool bonus Techniques.
Use Fine Silver Foil, Reactive Glass, and Fun Design Methods to achieve a visually stimulating and elegant finished glass bead.
Step-by-step easy to follow instructions on how to create a Monte Carlo Bead out of Soda Lime Glass.

Moth Wing Bead by Andrea Guarino
http://andreaguarino.etsy.com
15 pages, 36 images, 2.4mb file size, $24.00
This tutorial is a step by step description on how to make my MOTH WING BEAD. Also includes steps on silver fuming, feathering and shaping along with many other tips.

Multiplex Rose Lampwork by Gaye Doser
http://www.etsy.com/listing/42327070/multiplex-rose-lampwork-tutorials-by
$ 15,90; 20 pages, 5,5mb
In this step-by-step tutorial, I will show you how to make multplex rose with leaf designs.
This tutorial is for lampworkers who work with normal or special torches and gain some experience. If you have a knowledge and experience about many techniques, you can immediately understand these tutorials and put into practice.

Murano Chick Silver Glass by Daniel Caracas of sFd
http://www.artfire.com/modules.php?name=Shop&op=listing&product_id=673971
$ 5,=
Bring on the Elegant Evening Charm!
Learn a distinctive classic and chic design to add to your repertoire of glass bling~
Follow step-by-step easy instructions on how to create an elegant Murano-Style Chic Glass Bead out of Soda Lime Glass.

Murex Shell by Sislonski
http://www.etsy.com/listing/34246608/murex-shell-tutorial
$ 16,=; 42 pages, 103 photo’s
My new tutorial may be used to successfully complete a Murex Shelll in soft glass 104 coe, Bulls-eye 90 coe, 96 coe and Borosilicate glass 33 coe.
Variations for bulls-eye 90 coe and 96 coe - glass tubing as far as I know is not available, so you will need to build your Murex shell using a hollow mandrel.

Mushrooms and Fish by Moth / Mary Lockwood
http://marylockwood.etsy.com
14 pages, 100+ images
PDF version 3.0mb file size, $16.00 / Printed version $24.00
*A tall woodsy organic style mushroom
*A chubby little floral button mushroom
*A graceful fish with puffy lips and swishy fins

Nucleus Bead by Anne Ricketts
http://www.amrglassworks.net
http://www.aricketts.etsy.com
13 pages, 33 images, 1.5mb file size, $15.00
This is a step-by-step tutorial for making my Nucleus glass beads. I give instructions for the two beads pictured and a variation of the Nucleus bead. I've included everything from using frit and making stringer out of it to making a latticino or twisty cane and applying them to the final bead. You do need to have some experience on the torch before trying this technique!

Ornate Series by Jennifer Geldard
http://glassgirl.etsy.com
13 pages, 69 photos, 5.0mb file size, $19.00
This is a step-by-step tutorial on making my Ornate series focal beads.

Painted Rose by Lydia Muell
http://www.lampworktreasures.com/rosetutorial.html
17 pages, 1.2mb files size, $22.00
This tutorial includes a full tutorial for making the Painted Rose bead as well as separate mini tutorials for the roses, leaves and rosebuds. This is a very involved piece of work, so it's best suited for the advanced lampworker. All of the glasses are 104 COE. There are no special tools required.

Paisley Bead by Jessica Jane
http://www.jessicajane.ca/jessica_jane_may09_007.htm
$ 10,=
In this tutorial you will learn to make a Paisley Bead, a Yin Yang Bead and an Underwater Amoeba Bead. This is a beginner to intermediate tutorial. The only tools you need are a rake/poke tool and your marver, a lentil press is optional. You will need white and black glass and a variety of colors (you do not have to use the same colors I have).

Pearly Pink Floral by Kandice Seeber
http://www.lampworketc.com/ppc/showcat.php?cat=7
15 pages, 1.0mb file size, $10.00
This is a tutorial on how to make surface florals with pointed petals.

Pendant with Wire Woven bail by Julie Sigmund/Jewlie Beads
http://www.etsy.com/listing/42946312/tutorial-for-pendant-with-wire-woven
$ 8,=
Wire woven bails are a great way to display beautiful lampwork beads. Hang them on a chain, cord, or silk ribbon and you have a gorgeous necklace.
In this step-by-step tutorial, I will show you how to make 3 pendants with 3 different bail designs.

Perfecting the Pansy with Leaves and Honey Bees by Helen Harvest
http://helensharvest.etsy.com
Also available here on LE Classified
http://www.lampworketc.com/ppc/showcat.php?cat=7
33 pages, 54 images, 12.1mb file size, $100.00/$75.00 for repeat buyer
This eBook shows you how to carefully form my originally designed Pansy Bead with 5 grooved, layered and shaded petals, with Pansy blotches and a layered stamen center. I have included instructions for a veined and scalloped Pansy Leaf Bead for natural fliage, and instructions for my Honey Bee Bead also. This is for the advanced lampworker, requiring intuitive skill and control only experience can give. I suggest at least hundreds of hours before attempting to move the glass in these fashions. This ebook is too large to mail so has its own website.

Playa Tortuga by Patty Lakinsmith
http://PattyLakinsmith.etsy.com
18 pages, 34 images, $18.00
The tutorial is a collection of different tips and tricks that should help you create this design and improve your bead making. There are no real new techniques. It explains how to make eight different variations on this theme, and also explains how to diagnose and recover from five common mistakes you are likely to make with this bead. Specifically, you will learn how to make a large lentil bead using a press. You will learn how to twist a part of your design to create a swirled effect. You will learn how to use either a rake tool or a stringer to drag the stripes on the top part of the bead toward the bottom of the bead. You will learn how to get a metallic sheen out of silvered glass.

Pleated Vessel by Sandy / slcuniques
http://slcuniques.etsy.com
42 pages, 127 images, file to be downloaded only, $16.00
My new tutorial may be used to successfully complete a Pleated Vessel in soft glass 104 coe, Bulls-eye 90 coe, 96 coe and Borosilicate glass 33 coe. Variations for bulls-eye 90 coe and 96 coe - glass tubing as far as I know is not available, so you will need to build your own vessel neck using a hollow mandrel. The project takes approx. 1 hour to perform using boro glass but considerably less for soft glass 104 coe.

Precious Critters by PurpleLily Designs by Joanne Ortiz
http://www.etsy.com/listing/43911527/revised-version-precious-critters
$ 10,=; 14 pages, 23 photo’s
Precious Critters PENDANT & EARRINGS TUTORIAL
This project is for the novice and the advance.

Press Floral Bead by Kari Carigan
http://weegemsdesigns.etsy.com
10 pages, 20 images, $14.00
When I first discovered lampwork beads, floral are what "hooked" me to glass. I know many people also love them, but may struggle to make them, and I am hoping this tutorial will help you create your own garden of florals. This tutorial is mainly for the intermediate/advanced lampworker, but anyone can learn from it, the more information and techniques we learn, the better right?

Prince Charmer & Calla Lillies by Laurie Donnette
http://www.etsy.com/listing/37462575/prince-charmer-lampwork-tutorial-by
$ 11,=; 15 pages, > 40 photo’s
How to make My prince charmer frogs, and an encased calla lily bead.
Who doesnt Love frogs???!!!!
No special tools required,
I use common 104 soft glass in making this tutorial.

Raggedy Ann by Anne Ricketts
http://www.amrglassworks.net
http://www.aricketts.etsy.com
13 pages, 31 images, 0.6mb file size, $15.00
I've included detailed pictures for the steps to make your own baby doll! This tutorial is shows the prep work and the stages for building your Raggedy Ann beads with examples of finished doll beads as well. You do need to have some experience on the torch before trying this technique!

Rainbow Bead by J.C. Herrell
http://www.jcherrell.com/Rainbowtutorial.htm
$ 22,= 41 pages
This bright and vibrant tutorial includes 41 pages full of photographs and diagrams.  I wrote this tutorial for rainbow lovers and for, well, those who don’t love rainbows as much.  This tutorial focuses heat control, stringer application and practice, and enamel sifting (along with safety and properties of enamel).  You don’t have to love rainbows or even like them to find this information useful.  And that’s why I chose this bead, it requires a lot of attention to detail.

Rainbow Colors with Silver Glass – My Silver Glass Secrets by Christina Stofmeel
http://www.etsy.com/view_transaction.php?transaction_id=28086190
77 pages, 145 photo’s
It is finally finished! This is E-book is all About getting those vibrant colors out of your silver glass.
So in this E-book i will describe how to work with:
This will be included in my E-book
• Taxco
• Aurea
• Ekho
• Khaos
• Transcendental
• Dalai Lama
• How to make Snaketrail beads by cutting ( also known as pleated & Caterpillar beads)
• How to make Snaketrail beads by roling( also known as pleated & Caterpillar beads)
• How to make silver glass murrini (including how to pull stringers )
• Two ways to use silver glass murrini ( encased & unencased )
All the instructions are followed by Step-by-Step photo's

Rainbow Petal by Amy Trescott
http://www.amytrescott.com/rptutorialindex.html
html format, $11.95
I'm very happy offer an html (printable) version of my "Rainbow Petal Bead" Tutorial. You will receive step-by-step instructions (with color photos) on how to build this hypnotizing, multi-dimensional bead.

Rainbow Scale and Rain Drop by Shari Slonski /sislonski
http://etsy-lampwork.blogspot.com/
10 pages, 27 images, 0.4mb file size, $18.00
This technique is useful for all reactive glass. Part 1 focuses on using terra. Part 2 focuses on using the more transparent reactive glasses like Psyche. This technique can also be used on non reactive glass but will result in a differnt look in the end result.

Raven / Landscape Focal Bead Tutorial by Kerri Fuhr
http://kerribeads.etsy.com
28 pages, 79 images, 2.6mb file size, $25.00
This two-part tutorial illustrates in simple steps how I create a Northern Forest Landscape and a Raven. A bonus gallery of beads as well as a list of resources for further design ideas will keep you inspired on your own creative path as you master these skills!

Reaction in Glass by Daniel Caracas of sFd
http://sfdglassbeads.etsy.com
http://sortafloweringdesigns.com
14 pages, $5.00
This tutorial is about the gorgeous reactions you can get when combining different components to glass such as gold, silver, frit blends, and more.

Reactions 2007 by Sadie Cuming / SadiesJewels
http://sadiesjewels.etsy.com
30 pages, 83 images, CD, $10.00+shipping
The result of a collaboration of Lampworkers working with different glass reactions. Most of the reactions documented are104 coe glass. CD includes the recipes, descriptions and images of the beads and how to reproduce them.

Reactions 2008 + Shell Tutorial by Sadie Cuming / SadiesJewels
http://sadiesjewels.etsy.com
56 pages, 119 images, CD, $15.00+shipping
Another wonderful catalog of exchange beads all with creative and reactive reactions with some new reactions not in the 2007 exchange CD. If you like reactions you'll love this one! CD comes with an additional reactive shell tutorial by myself (6 pages), and a "Magic" stringer tutorial by Sue Stewart who kindly let me include it!

Recycled Wire Swirls Bracelet by Maria / whimzicalities
http://LostMarbles.etsy.com
11 pages, 34 images, 1.4mb file size, $15.00
This tutorial will help you create your own recycled/reclaimed copper wire bracelet. There are many sources out there for recycled wire and I will explain these, as well as my technique for annealing the wire if you have a lampworking or other type of kiln. Wire purchased dead soft from a jewelry supplier may also be used. This tutorial is suggested for the intermediate wire worker, but I believe with practice with lighter gauge wire, this can be done by beginners as well. It is packed with instruction, photos, hints and resources.

Reef Necklace by Tease Beads
http://www.etsy.com/shop/teasebeads?section_id=6266309
$ 17,50
Have you seen my bronze-prize winning Reef necklace and wanted to make your own? I now offer a tutorial teaching how to make this incredible necklace! This fully-detailed tutorial includes 30 large, full color photographs and directions for how to condition your thread, stitch the necklace, and even make my handmade ball-and-loop clasp.
On the right are some sample pictures from the tutorial. There are no special tools needed, just beads, needle, beeswax, and thread. I am also available to answer any questions you may have after purchasing my tutorial.

'Roly Poly' Bead Tutorial – Laura / beadsbylaura
http://www.beadsbylaura.co.uk/BBLDownloads.htm
£4.99 GBP, 6 pages (about US$8.00)
It's a relatively simple bead to make but you will need to have good heat control and nimble mandrel-turning fingers! You'll also need a lentil press, a graphite marver and some mashers.

Rose Murrini by Mperaza
http://www.etsy.com/listing/37729399/rose-murini-tutorial-in-pdf
$ 24,95
Learn to make the murini for use in making roses in your lampwork beads such as seen here. Give your beads a 3-deminsional look with depth and definition!

Rustic Heart Earrings by Julie Sigmund/Jewlie Beads
http://www.etsy.com/listing/45582768/tutorial-for-rustic-heart-earrings-buy
$ 10,=
In this step by step tutorial I will show you how to make my "Rustic Heart Earrings".
« Last Edit: April 27, 2010, 08:11:55 AM by Maria Louisa » Logged

Maria Louisa
Maria Louisa
Forum Member
***
Posts: 115


WWW
« Reply #5 on: April 26, 2010, 09:19:17 AM »

Rustic Swirled Paisley Earrings by Julie Sigmund/Jewlie Beads
http://www.etsy.com/listing/45527055/tutorial-for-rustic-swirled-paisley
$ 10,=
In this step by step tutorial I will show you how to make my "Rustic Swirled Paisley Earrings".
This tutorial will be in PDF format and sent to your e-mail within 12 hours or sooner after payment is recieved. If you would like your tutorial sent to a different e-mail, please let me know when you order. You will need Adobe Reader to open this file.

Samantha Beads DVD by Samantha/SamanthaBeads
http://SamanthaBeads.etsy.com
This is a demo DVD with commentary, over an hour long, of me making the following beads, :
1. Vine Cane Stringer
2. Encased Floral
3. Turtle Bead
4. Duck part one and two

Santa Claus Face by Marcy Lamberson
http://studiomarcy.etsy.com
0.4mb file size, $16.00
Ho, ho, ho... Santa Claus is ready for Christmas and wants you to be also. As many of you know, I've been doing online sculptural bead coaching on my blog, and a natural off shoot is writing tutorials too. Here's a sculptural Santa Claus face that I have made an easy tutorial for even the non-sculptural beadmakers. Santa can be used as a focal bead, a Christmas tree ornament or even a package decoration.

Sarah's 12 Favorite Color Schemes by Sarah Hornik
http://blog.glassbysarah.com/2008/12...they-work.aspx
12+cover pages, 50 images, 2.7mb, $10.00
Also available a printed calendar
http://www.lulu.com/content/5290543

Say Cheese! Mouse Tutorial by Maria / whimzicalities
http://www.lampworketc.com/ppc/showcat.php?cat=7
27 pages, 60 images, 4.1mb file size, $15.00
I’ve been making wire critters for years and want to share one of my favorites. While the soldering may seem intimidating if you’ve never done it before, it really isn’t difficult at all. It is soft soldering: sort of a cross between soldering for stained glass and soldering for electronics. I’ll take you through step-by-step, so you’ll learn the process along the way. You’ll start out with a little bit of wire and a couple of beads and wind up with this little personality…often with an attitude that somehow just happens along. Mice are awesome little companions for bookshelves, desks and studios. Best of all, there’s no cleaning up after wire and glass pets! This tutorial is packed with instruction, photos, diagrams and resources. The instructions are intended for copper wire and lampwork beads.

Sculpted Lampwork Pansy by Laurie Donnette
http://everafterartistry.etsy.com
I]25 pages, 35 images, 1.7mb file size, $13.00[/i]
This tutorial contains step-by-step instruction on how I make my sculpted lampwork Pansies. Lots of pictures! lots of fun! Techniques include layering the glass, shaping the petals, creating your begining canvas! and more! This tutorial is geared toward people with a good understanding of lampwork techniques and safety concerns.

Sculpted Sweetheart Rose by Laurie Donnette
http://everafterartistry.etsy.com
25 pages, 1.5mb file size, $13.00
Step by step on how to construct a lampwork sweetheart sculpted rose, MY way.. This tutorial uses completely different sculpting techniques than my previous Pansy tutorial. And as a bonus I have included how to make a bluebird of happiness and a contemporary sculpted leaf!!

Sculpting A Lampwork Flower Bead by Helen Harvest
http://helensharvest.etsy.com
Also available here on LE Classified
http://www.lampworketc.com/ppc/showcat.php?cat=7
27 pages, 17 images, 2.2mb file size, $100.00
Having worked 6 years developing my original, basic techniques through creating thousands of Sculpted Flower Beads, I am finally taking a Sabbatical Year to write my discoveries. I will still make SOME Beads, but am ready to share my realistic, botanical passion with you. This Ebook, Sculpting a Lampwork Flower Bead, is for the advanced lampworker, requiring intuitive skill and control only experience can give. I suggest at least hundreds of torch hours before attempting to move the glass in these fashions.

Sculptural flower bead tutorial
http://www.glassbead.etsy.com
Well, I wrote my first ever big tutorial and donated a copy of it, along with an orchid an an aster made using the directions, to the ISGB for their auction on ebay. The auction ends soon, and there is not a single bid yet. Thought I'd advertise it here. Here's the link: http://cgi.ebay.com/ISGB-Laurie-Amen...item3cac5218e0
And the tutorial by itself will soon be available in my etsy shop- next week if not sooner- for what I think is a reasonable price. It is over thirty pages long, with lots of pictures, and includes instructions for four different flowers.

The Sculptured Rose by Mperaza
http://www.etsy.com/listing/37729454/the-sculptured-rose-tutorial-in-pdf-as
$ 15,=
Intermediate to Advanced.
Don't worry about putting "pieces" of your work into the kiln while you work on other parts... I'll show you how to make Sculptured Roses in one solid piece. Working knowledge of lampworking is recommended before attempting to make these beads. Also available on DVD.

Sea Horse by Sandy / slcuniques
http://www.etsy.com/listing/37041772/sea-horse-tutorial-only
$ 20,= 42 pages, 128 pictures
The Sea Horse tutorial may be used to successfully complete a Sea Horse in soft glass 104 coe, Bulls-eye 90 coe, 96 coe and Borosilicate glass 33 coe.
Please see Materials and tools list at the bottom of this description.
The project takes approx. 1 hour to perform using boro glass but considerably less for soft glass 104 coe.
Step by step written instructions include preparations for your glass parts and tools needed to successfully perform this project.
INCLUDED ARE: Cover page, Intro page -as show in the photo, Contents page, Tutorial &
Materials and tools page.

Sea Shells by Diane Woodall and Becky Mason
http://www.etsy.com/listing/33797104/on-sale-small-seashell-collection
$ 10,=; 21 pages, 55 photo’s
how to make five small shells - Cowrie, Nautilus, Fan shell, Urchin and Auger. We also included 12 gallery pictures to whet your appetite and spur your imagination!
Our instructions are very easy to follow and the tutorial is peppered with “oodles” of helpful tips that will make it even easier to make the beads.
In this tutorial we share with you all of our secrets so that you can create small seashell beads just like the ones we make. We didn’t hold anything back. Everything we know about making small seashell beads is in this tutorial.
You don’t need any special tools to make these beads, beyond a bead press, some basic shaping tools and a marver. Some beadmaking experience is recommended; however, we think that even beginners can learn a lot from our easy to follow instructions.
We both make our beads in the middle of the mandrel, so we've included step-by-step instructions on how we coat our mandrels, in case you want to give it a try. If you make your beads on the end of the mandrel you will still be able to get great results.

SE2 – Second Silver Color How To e-Booklet compiled by Hayley Tsang
Click Here for more information or instant-download purchase
65 pages, 170+ images, 2.0mb file size, $15.00
High Res CD version is also available, 50mb file size, $25.00
This booklet is a compilation of exchange beads submitted for the Second Silver Color How To and Exchange. Each bead is accompanied by the recipes of glasses used and some have detailed step by step description of how the bead was made (the level of detail is based on how much information the original beadmaker shared.) Other content includes a list of silver glass by manufacturers and notation of the glass being striking or reducing, and index of each silver glass used in the booklet for easy reference, and a basic step-by-step written instruction on how to strike and how to reduce silver glass.

SE3 – Third Silver Color How To e-Booklet compiled by Hayley Tsang
Click Here for more information or instant-download purchase
72 pages, 180+ images, 2.8mb file size, $18.00
High Res CD version is available, 30mb file size, $28.00
Spiral Bound, Printed Book is available, $43.90
This booklet is a compilation of exchange beads submitted for SE3 – Third Silver Color How To and Exchange. There are over 180 beads with description. Each bead is accompanied by the recipes of glasses used and some have detailed step by step description of how the bead was made (the level of detail is based on how much information the original beadmaker shared.) Other content includes a list of silver glass by manufacturers and notation of the glass being striking or reducing, and index of each silver glass used in the booklet for easy reference, and a basic step-by-step (illustrated with photos) instruction on how to strike and how to reduce silver glass.

SE4 – Fourth Silver Color How To e-Booklet compiled by Hayley Tsang
http://envisionsf.blogspot.com/2010/01/se4-fourth-silver-color-how-to-e-book.html
$ 19,=
Finally finished . . .
- 80 pages plus cover
- over 200 beads with description
- list of silver glass by manufacturers
- index for each silver glass used in the booklet
- silver glassmakers featured: Double Helix, Effetre, GTG, Lauscha, Precision 104, Reichenbach 96 and 104, StrikingColor, TAG, Gaffer, Kugler, Zimmerman and Bullseye
- step-by-step instruction on striking silver glass with photos
- step-by-step instruction on reducing silver glass with photos
- please note that this e-Book does not contain any beads made with Ekho

Silver Glass - a guideline by Angel by Angela Meier
http://www.lampworketc.com/forums/sh...d.php?t=123486
17 pages, 2.7mb file size, $20.00
It took me six weeks of work and four years of learning by doing... The e-bookcontains my whole know-how about working with silver glass. . . you should be able to rework all beads shown in the book. Content: how to reduce / cool reducing / metallic effects with step by step tutorial / glass for metallic effects and gallery / reduce and strike I with steps and gallery / reduce and strike II with steps and gallery / heat and strike with steps and gallery / kilnstriker / glass overview following the chapters of the book / last page with suggestion for startersets, credits and other last page stuff

(Coral) Sand Shards by Shari Slonski
http://etsy-lampwork.blogspot.com/
$5.00
This tutorial is on how to create one of my Secret recipes. This recipe is a secret mixture of glass that I came up with when trying to achieve that stoned look for my Arrowhead beads. This tutorial is not only on how to create the recipe but also on actually blowing the shards, which is all part of the process

Space Flowers Murrinis by Karin / Beadfairy
http://Beadfairy.etsy.com
12 pages, 44 images, $20.00
I finished the tut also in english now! I was asked a few times how I do those little murrinis I call "Space Flowers" so I decided to make a tutorial.

Spiral Fibula Pin Wire by Lampwork by Lori
http://www.etsy.com/listing/43255309/spiral-fibula-pin-wire-tutorial
$ 10,=; 13 pages
I don’t know about you, but I am really drawn to big beads — especially long beads. But how can you really wear them aside from as a pendant? Well, you can make them into pins! Fibula pins are easy and make wonderful statement pieces. They are also great gifts along with a pair of matching earrings.
I’ve designed this fibula pin to include a decorative coil formed into a spiral embellishment at one end of the pin.
This tutorial includes two options for the coil: a straight coil, shown in Figure 1; and a coil made of twisted wire, shown in Figure 2.
This tutorial is divided into three parts, and each on their own is a valuable mini tut:
• Making the Twisted Wire (Optional)
• Making the Coil
• Making the Spiral Fibula
I encourage you to experiment and use different gauges and shapes of wire for the coil as well as different shapes for the “spiral” such as triangles and organic shapes.
Experience Level: Advanced Beginner or higher

Starburst Murrini Pendant by Dustin Tabor
http://www.dustintabor.com/tutorial.htm
70+ images, 28 pages, $25.00
Full step-by-step instructions and photographs are provided for how to make the murrini cane in the center, the ribbon cane edging, and the pendant itself. Helpful hints are provided along the way not only to help you successfully complete this project, but also to help improve your flameworking skills overall. All of the techniques presented can also be adapted to create a variety of other beads and pendants besides the one detailed in this tutorial. The "off-mandrel" technique detailed here can adapted to create an amazing variety of pendants and sculptural objects in the flame. This tutorial was written using Effetre glass, but it can be used to create similar projects in a variety of glass formulas.

Starburst And Nebula Style Beads by Debra / Frogsongstudio
http://FrogsongStudio.etsy.com
17 pages, $18.00
A tutorial of step-by-step instruction on four styles of beads. And a final page of sample beads that I have made using the techniques in this tutorial.

Starry Nights by Laurie Donnette
http://everafterartistry.etsy.com
1.95mb file size, $14.01
Step-by-step tutorial on how to construct a lampworked Celestial-like bead, as well as how to make your very own star cane and millis – with very affordable tools.

Study in Lampwork Berries 5in1 by Laurie Donnette
http://www.etsy.com/listing/41426336/study-in-lampwork-berries-5-tuts-in-1-by
$ 11,= 31 pages 80 photo’s 1,67mb
Step by Step tutorial of making scrumdiddlyumptious looking Berries, and blossoms
Including blueberries, strawberries, raspberries, blackberries, and a blossom to boot!

Sunflowers and Strawberries by Laurie Donnette
http://everafterartistry.etsy.com
25 pages, 50 images, 2.0mb, $14.00
Step-by-step instructions on how I make sculpted sunflowers, and strawberries!!! Techniques include layering the glass, shaping the petals, creating your begining canvas! and more! This is my third in my series of sculpted lampworked flowers, each using different sculptural glass techniques. This tutorial is geared toward people with a good understanding of lampwork techniques and safety concerns.

Surf and Turf Lampwork Bead Tutorials - Seashells and Animal Prints - Three tutorials by Diane Woodall and Becky Mason
http://BeckyMason.etsy.com
http://dianewoodall.etsy.com
Focal Shells: 26 pages, 72 images, 1mb file size
Small Shell Collection: 21 pages, 55 images, 747k file size
Animal Prints: 21 pages, 41 images, 1mb file size
All three for $50.00
Focal Shells (fan shell, conch shell, sand dollar), Small Seashell Collection (cowrie, nautilus, fan shell, urchin and auger), and Animal Prints (zebra, tiger, ocelot, leopard, snow leopard, cheetah, giraffe and crocodile/alligator)
We are proud to offer our step-by-step tutorials on how to make our seashell beads and animal print beads, just like the ones we have been selling for years on eBay and in our Etsy stores. Best of all, we are offering our tutorials in both right-handed and left-handed versions. Just let us know when you order which version you’d like.

SWIRL – an e-book on Gravity Swirl, Bicone Shaping, and Silver Glass by Hayley Tsang
Click Here for more information or instant-download purchase
21 pages, 50+ images, 2.5mb file size, $21.00
This is a three-in-one tutorial for both newer and more experienced lampworkers. Using the techniques on how to make a gravity swirl bead, I will share with you how to shape a perfect bicone AND show you how to work with using both striking and reducing silver glass on a single bead. Please do note that the silver glass part of this tutorial is secondary. There is a lot of information after the tutorial, including my favorite - Shaping 101! As many of you know . . . my passion is silver glass . . . but my obsession is perfectly shaped and executed forms. If you have ever wondered how I made my beads stand up on both ends perfectly perpendicular to the table top, here is your chance to find out!

Swizzle Stick Tutorial with Inclusions by Kay Lodahl aka LAG
http://lodahlartglass.etsy.com
5 pages, $10.00
This pdf download has a lot to offer, particularly the beginning boro worker. I tried to consolidate the information to provide speed and little use of ink and paper on printout. These can be made on a minor burner and make great hostess gifts for any time of year. They are fun to make and the possibilities for inclusions are endless.
Perhaps you can sell these at your local latte shop or deli bistro?

Tahitian Sunrise Bead by Daniel Caracas of sFd
http://sfdglassbeads.etsy.com
http://sortafloweringdesigns.com
7 pages, 25 images, $6.00
Sunrise hues with glyph style reactions and a dazzling gilt rustic silver finish. Learn to make a press or free-form tab bead using unique glass and metal Reactions, as well as encasing techniques. This is a beginning to intermediate tutorial in which you will use silver foil and rubino along with other reactive glass to achieve gorgeous sunrise and sunset glowing effect.

Taking Reduction Glass by Storm by Amy Kinsch
http://beeswaxrubberstamps.com/lampworkbeads.htm
$ 19,=; 15 pages, 41 pictures, > 60 sample beads + color layering chart, 1 mb
This tutorial covers a couple of unique techniques using 104 coe silver reduction glass. It's for all levels of expertise from the beginner with the basics down, all the way to the advanced lampwork artist. You will only need a torch, mandrels, tweezers, marver and reduction glass to get started.

Tapestry Scrollwork by Kerri Fuhr / KerriBeads
http://kerribeads.etsy.com
16 pages, 32 images, 2.0mb, $28.00
This is a detailed, step by step tutorial on how I create the intricate botanical scrollwork on my Tapestry beads! A bonus gallery of beads as well as a list of resources for further design ideas will keep you inspired on your own creative path as you master these skills! This tutorial is designed for the intermediate/advanced lampwork artist, however beginners will find this information useful in helping to enhance their skills at the torch as well.
« Last Edit: April 27, 2010, 08:12:26 AM by Maria Louisa » Logged

Maria Louisa
Maria Louisa
Forum Member
***
Posts: 115


WWW
« Reply #6 on: April 26, 2010, 09:19:50 AM »

The Beast by Pipyr
http://pipyr.etsy.com
http://www.pipyr.com/newsletter.html
74 pages, 6,6mb, $20.00
Here be the Beasts!! This tutorial covers the making of three different kinds of my "Beasts" out of borosilicate glass. At the end, there is a section on my favorite colors and color combos with pictures of the finished examples and tips on how to get the most out of each color. There is a heavy emphasis on Momka's Glass, because it's all awesome. It is my hope that this tutorial gives you lots of information to apply to any kind of borosilicate sculpture work.

The Creature by Pipyr
http://pipyr.etsy.com
http://www.pipyr.com/newsletter.html
46 pages, 87 images, 2.2mb, $20.00
A tutorial about how to make a creature from solid borosilicate glass rods (no tubing)! I have spent a lot of time on this, trying to make it as clear as possible so that anyone can make a creature. I wrote this tutorial with the assumption that many people using it will have never used borosilicate glass before. I have info about proper seals, color, clear sizes that I commonly use, etc. Then I go into how to make the creature with photos to highlight everything from beginning to end. You should have a torch with a decent oxygen supply to use this tutorial. It can be done on a minor with one oxygen concentrator with some adjustments that are noted in the tut, but it is painfully slow on a set-up like that. Ideally, you will be able to run a small torch at near full capacity.

Think Pink / Rubino Oro by Sarah Hornik
http://www.glassbysarah.com/ebooks/thinkpink/
43 pages, 130 images, 3.5mb, $22.50
The book is divided into four sections. In the first part, you will find loads of information about Rubino Oro and tips on how to work with it. The second section, Ideas and Inspiration, contains many photos and descriptions of various techniques I have worked with over the past couple of years. The third and fourth sections are full step-by-step tutorials for two of my signature styles: the Flower Child Bead and the Barbie Bling Bead.

Tie-Dye Flowers and Plaids by Anne Ricketts
http://www.amrglassworks.net
12 pages, 27 images, 1.9mb, $15.00
This is a step-by-step tutorial for making my Tie Dye Flower and Plaid glass beads. I've included everything from where I get my inspiration to putting on the final touches for making a Tie Dye and Plaid beads. It shows the stages for building your Tie Dye flower and Plaid beads with examples of finished beads. You do need to have some experience on the torch before trying this technique!

Toad Bead by Theresa Laliberte' / LavenderCreek
http://www.lavendercreek.etsy.com
48 pages, 72 images, 3.7mb, $28.00
In this tutorial you'll learn exactly how to make my toads and frogs! Iis not just a simple step-by-step project but is a powerful tool to help you to further develop your skills as a glass artist. You will learn not only the hows but also the whys. This will help you to take the techniques and knowledge you gain from this tutorial and apply it within your own work so that you'll be able to create unique sculptural beads all your own.

Top Secrets Revealed Volume A, B, C & D by Daniel Caracas of sFd
http://www.artfire.com/modules.php?name=Shop&op=listing&product_id=414410
$ 18,99 
Learn the Recipes for some of our most stunning and best selling Glass Lampwork Bead Designs!
Receive all four volumes A-D in the series at a discounted price.

Tribal Bead by Anne Ricketts
http://www.amrglassworks.net
http://www.aricketts.etsy.com
12 pages, 22 images, 1.7mb, $15.00
This is a step-by-step tutorial for making my Tribal Tube glass beads. I've included everything from where I get my inspiration to putting on the final touches for making a Tribal Tube bead.

Tribal Sundance by Daniel Caracas of sFd
http://sfdglassbeads.etsy.com
http://sortafloweringdesigns.com
12 pages, 46 images, 1.6mb file size, $5.00
Learn to make a Focal Press Bead, or Organic Press Bead using unique Glass and Metal Reactions. This is a Beginning to Intermediate Tutorial in which you will use Silver Foil, Hand-Pulled Goldstone, and Raku, along with other Reichenbach and Effetre reactives to achieve gorgeous Patterned effects.

Tribal Series : Fireside Diamond by Daniel Caracas of sFd
http://www.artfire.com/modules.php?name=Shop&op=listing&product_id=794133
$ 5,=; 12 pages
Elemental Tribal Design with reactive glass- Use this tutorial with a Crystal Press, other press such as Button or Lentil, or on a handshaped bead as well.
Bonus material included, this is a beginning to intermediate tutorial.
Step-by-step easy to follow instructions on how to create an Fireside Diamond Bead out of Soda Lime Glass.

Tribal Series : Midnight Jewel by Daniel Caracas of sFd
http://www.artfire.com/modules.php?name=Shop&op=listing&product_id=860500
$ 5,=; 12 pages
Richly Decorated Tribal Design with reactive glass- Use this tutorial with a Button, Spree, Tab, or other press, or on a Hand-formed bead as well.Bonus material included, this is an intermediate tutorial. Step-by-step easy to follow instructions on how to create an Midnight Jewel Button Bead out of Soda Lime Glass

Tribal Series : Rustic Onyx Diamond by Daniel Caracas of sFd
http://www.artfire.com/modules.php?name=Shop&op=listing&product_id=794134
$ 5,=; 12 pages
Earthen & Elegant Tribal Design with reactive glass- Use this tutorial with a Crystal Press, other press such as Button or Lentil, or on a hand-formed bead as well.
Bonus material included, this is a beginning to intermediate tutorial.
Step-by-step easy to follow instructions on how to create a Rustic Onyx Diamond Bead out of Soda Lime Glass.

Tribal Series : Sedona Button Jewel by Daniel Caracas of sFd
http://www.artfire.com/modules.php?name=Shop&op=listing&product_id=1154211
$ 5,=; 12 pages
Brilliantly Detailed Tribal Design with reactive glass- Use this tutorial with a Button, Spree, Tab, or other press, or on a hand-formed bead as well.Bonus material included, this is a beginning to intermediate tutorial. Step-by-step easy to follow instructions on how to create an Sedona Button Bead out of Soda Lime Glass.

Tribal Series : Zanzibar Button by Daniel Caracas of sFd
http://www.artfire.com/modules.php?name=Shop&op=listing&product_id=794123
$ 5,=; 10 pages
Crisp Striking Tribal Design with reactive glass- Use this tutorial with a Button, Spree, Tab, or other press, or on a hand-formed bead as well.
Bonus material included, this is a beginning to intermediate tutorial.
Step-by-step easy to follow instructions on how to create an Zanzibar Button Bead out of Soda Lime Glass.

Tribal Series : Zanzibar Diamond by Daniel Caracas of sFd
http://www.artfire.com/modules.php?name=Shop&op=listing&product_id=806195
$ 5,=; 10 pages
Crisp Striking Tribal Design with reactive glass- Use this tutorial with a Crystal Press, other press such as Button or Lentil, or on a Hand-formed bead as well.
Bonus material included, this is a beginning to intermediate tutorial.
Step-by-step easy to follow instructions on how to create an Zanzibar Diamond Bead out of Soda Lime Glass.

Twisted Pixie Dots by by Laurie Donnette
http://www.etsy.com/shop.php?user_id=70033
$ 11,= 19 pages 43 photo’s
Learn hot to make hollow globes and encased latticino!
a lot of fun no special tools other than a hollow mandrel required!

Wavy Crinkle Disks by Daniel Caracas of sFd
http://www.artfire.com/modules.php?name=Shop&op=listing&product_id=414404
$ 5,=
Learn Six New Recipes for Wavy Crinkle Disks PLUS three step by step Tutorials.

Wild Brightz Bead by Anne Ricketts
http://www.amrglassworks.net
http://www.aricketts.etsy.com
12 pages, 25 images, 1.5mb file size, $15.00
This is a step-by-step tutorial for making my Wild Brightz tube and lentil shaped glass beads. I've included everything from where I get my inspiration to putting on the final touches for making Wild Brightz beads.

Wild Flower by Carla
http://www.etsy.com/shop.php?user_id=5172344
26 pages, 40 images, 1.3mb, $14.00
special discount of $20 for both Wild Flower and Fantasy Butterfly Tutorials together
This is a TUTORIAL for my popular "Wild"Flower. I have been asked several times to teach how to do this popular flower design, so I thought I would go ahead and put out a tutorial for it! This tutorial is mainly for the intermediate/advanced lampworker, but if you are just starting out you will also get a lot out of it. If you are a Hothead user, you CAN use this tutorial!

Wild Garden by Daniel Caracas of sFd
http://sfdglassbeads.etsy.com
http://sortafloweringdesigns.com
10 pages, 43 images, 1.8mb file size, $5.00
Learn to make a Focal Press Bead, or Organic Press Bead using Earthen reactions. This is a Beginning to Intermediate Tutorial that zeroes in on some specific skill sets. You will use Enamel and Copper Foil, Silvered Ivory and Raku, along with other unique glass shaping techniques to achieve gorgeous Organic effects.

Window Series by Jennifer Geldard
http://glassgirl.etsy.com
Also available here on LE Classified
http://www.lampworketc.com/ppc/showcat.php?cat=7
$17.00
This is a step-by-step tutorial on making my Window series focal beads.

Wire Wrapped Cuff Bracelet by Julie Sigmund/jewlie beads
http://JewlieBeads.etsy.com
20 pages, 84 images, $12.00
In this step-by-step tutorial, I will show you how to make my wire wrapped cuff bracelet.I also explain how to make 2 different types of cuff bracelet frames. One frame involves fusing the ends of copper wire together and the second cuff frame doesn't involve fusing for those who don't have a torch.

Wire Wrapped Flower Pendant by Julie Sigmund/jewlie beads
http://www.etsy.com/listing/38361514/tutorial-for-wire-wrapped-flower-pendant
$ 10,= 26 pages 44 steps.
This is a step by step tutorial for my Flower Pendant.

Wire Wrapped Heart Fibula by Julie Sigmund/jewlie beads
http://www.etsy.com/listing/45069819/tutorial-for-wire-wrapped-heart-fibula
$ 11,=; 34 pages & 55 steps
Beautiful Fibulas make the perfect addition to those thick cozy sweaters or to simply hold a scarf or shawl in place. In this step by step tutorial I will show you how to make my "Wire Wrapped Heart Fibula".

Wire Wrapped Hoop Earrings by Julie Sigmund/jewlie beads
http://JewlieBeads.etsy.com
12 pages, 41 images, $8.00
Please see Etsy listing description for tools and materials needed.

Woodland Fern Earrings by Julie Sigmund/jewlie beads
http://www.etsy.com/listing/44002384/tutorial-for-woodland-fern-earrings-buy
$ 10,=
In this step-by-step tutorial, I will show you how to make my wire wrapped and fused Woodland Fern Earrings. You will need a torch and some experience with fusing copper.
Wrapped Bumble Bee Pendant by Julie Sigmund/jewlie beads
http://www.etsy.com/listing/43009181/tutorial-for-wire-wrapped-bumble-bee
$ 13,= 30 pages 62 steps.
In this step by step tutorial, I will show you how to make my wire wrapped bumble bee pendant. Using a torch is optional. The bee can be made with or without any fusing.
« Last Edit: April 27, 2010, 07:01:11 AM by Maria Louisa » Logged

♥♥Tan♥♥
cuntbuckets
Forum Member
*******
Posts: 1300



WWW
« Reply #7 on: April 26, 2010, 09:39:43 AM »

Excellent, can you tell us how you found them to work with? This is the important bit for us I think, we need to know if there were enough pictures, easy to follow, accessible glass, adaptable for boro or soft glass, any tools needed can anyone think of anything else we need to know?
Logged

Maria Louisa
Maria Louisa
Forum Member
***
Posts: 115


WWW
« Reply #8 on: April 26, 2010, 10:05:35 AM »

I'll see what I can do. That's a lot of work.
First I will finish the update so the list will be complete.
Logged

SilverGems89
Forum Member
****
Posts: 486

Hot Cheeks


« Reply #9 on: April 26, 2010, 10:15:55 AM »

i've only bought these few so far

Think Pink by Sarah Hornik
http://www.etsy.com/listing/45266854/think-pink-an-e-book-about-rubino-oro-by?ref=vl_other_1
This is a fantastic tutorial, everything you need to know about rubino oro and lots of way to work it including the 2 step-by-step bead tutorials, this gave me ideas for working with lots of other colours as well so i would definately recommend it. The pictures are fantastic, and there are plenty of them, its well written and actually just quite nice to look at! All the information on glass chemistry really helped me and i would say it would be a good tutorial for any skill level. Well worth the money!

Goddess tutorial by Teresa Laliberte
http://www.etsy.com/shop/LavenderCreek
Having only been lampworking for 2 months when i bought this tutorial i expected it to be far beyond my skill level, but the steps are so well explained and the pictures are so good i managed to get a decent looking goddess on my second try! Extremely well written and i would recommend to anyone who was wanting to try something more sculptural.

Focal seashells by Becky Mason and Diane woodall
http://www.etsy.com/listing/44038876/sale-focal-seashells-lampwork-bead?ref=vl_other_1
I havent tried any of the techniques in this one yet but having read it through a few times its simple to understand and the pictures are great, i'll update this when i have tried it out!
Logged

♥♥Tan♥♥
cuntbuckets
Forum Member
*******
Posts: 1300



WWW
« Reply #10 on: April 26, 2010, 10:52:08 AM »

I'll see what I can do. That's a lot of work.
First I will finish the update so the list will be complete.

Thankyou Maria Lousia, I'm sure anyone else who has these tutorials can write them up for you as well Wink
Logged

Maria Louisa
Maria Louisa
Forum Member
***
Posts: 115


WWW
« Reply #11 on: April 26, 2010, 04:00:50 PM »

I've updated the list. Hope it's complete now, it took me a couple of hours.
If I have time I'll double check tomorrow.

Tuesday April 27:
I'll checked the complete list and added a lot more tutorials to it.
Hope it's a complete picture now.
« Last Edit: April 27, 2010, 07:02:24 AM by Maria Louisa » Logged

Veebee
Superglassyfrittylisticgirlmakes beadsatrocious!
Forum Member
****
Posts: 392


Serial HotHead on bulk user and glass murderess.


WWW
« Reply #12 on: April 26, 2010, 04:11:28 PM »

Wow Maria Louisa, fantastic effort!

Can I add that the Baleen tutorial is totally suitable for a Hot Head (Michael wasnt sure and stated so in his description, but I have it and it's fine)

 Grin
Looks like non lampie tut's are OK too?
Kerrie Slade Core Beaded Bead Tutorial:
http://www.kerrieslade.co.uk/page9.htm
12 Pages, 21 photo's / illustrations

This is an intermediate beadwork project to create a beaded bead with a central beaded core.  You should have a working knowledge of peyote, herringbone and ladder stitch.  These instructions are to make a beaded bead (in the pattern shown) only and do not include instructions for the bracelet and/or necklace.

Clear, easy to follow instructions. It seems complicated when you first read through, but take the plunge and get stuck in and all becomes clear.
Kerrie is happy for you to sell beads made with this tutorial, but please give credit to her for the original design.

Lynn Davy (Nemeton) Sparkle Pendant

http://www.etsy.com/listing/45423089/picknmix-set-of-4-beadweaving-tutorials

Number 11. 11 Sparkle Pendant - circular brickstitch pendant with lots of crystals
Easy enough for a beginner, very clear instructions, and easy to modify for your own needs. Lynn is happy for you to sell pendants made with this tutorial, but please give credit to her for the original design.
(I'll update with stats soon)
« Last Edit: April 26, 2010, 06:18:20 PM by Veebee » Logged

Web: http://www.veebeads.net
The UK home of Val Cox frit!!
Fritt Flickr group: http://www.flickr.com/groups/1647822@N25/
Kaz
Flame Off Show Off
Senior Forum Member
*
Posts: 1251


Worth my weight in glass....


WWW
« Reply #13 on: April 26, 2010, 05:10:44 PM »

Taking Reduction Glass by Storm by Amy Kinsch
http://beeswaxrubberstamps.com/lampworkbeads.htm
$ 19,=; 15 pages, 41 pictures, > 60 sample beads + color layering chart, 1 mb
This is my favourite tutorial out of all the ones I have bought as it is a technique developed by Amy and something new and interesting to do with silver glass.
Used for these

and this

Kazx
Logged

She's made of real glass. She got real real emotion. But my heart laughs I have that same sweet devotion!
JewelsK
New Forum Member
*
Posts: 20


Bring me sunshine...


« Reply #14 on: April 26, 2010, 07:53:24 PM »

As listed above by Maria Louisa, the below is currently "on sale" at $25 for all three tutorials!
http://www.etsy.com/listing/45436699/on-sale-surf-and-turf-lampwork-bead

Surf and Turf Lampwork Bead Tutorials - Seashells and Animal Prints - Three tutorials by Diane Woodall and Becky Mason
http://BeckyMason.etsy.com
http://dianewoodall.etsy.com
Focal Shells: 26 pages, 72 images, 1mb file size
Small Shell Collection: 21 pages, 55 images, 747k file size
Animal Prints: 21 pages, 41 images, 1mb file size
Logged
Pages: [1] 2
  Print  
 
Jump to:  

Powered by MySQL Powered by PHP Powered by SMF 1.1.21 | SMF © 2015, Simple Machines Valid XHTML 1.0! Valid CSS!
Page created in 0.097 seconds with 18 queries.