Frit-Happens !
June 13, 2021, 10:36:06 AM *
Welcome, Guest. Please login or register.

Login with username, password and session length
your ad here
News:
Where are you?? Add yourself to the NEW FHF map here  | On flickr? Join our Frit Happens group: here

VISIT THE WIKI HERE
Get FH Status updates via twitter @FritHappens

 
   Home   Help Search Calendar Login Register  
Pages: 1 [2]
  Print  
Author Topic: Tutorials- the why, the where and the how.  (Read 79943 times)
0 Members and 1 Guest are viewing this topic.
Yellow friend
Forum Member
***
Posts: 219



WWW
« Reply #15 on: May 04, 2010, 11:47:41 AM »

Has anybody tried Lydia Muell's

Encased Floral Panel Tutorial (Encased Floral Panel Series)

(am I allowed to ask this question?)

Shelia
Logged

♥♥Tan♥♥
cuntbuckets
Forum Member
*******
Posts: 1300



WWW
« Reply #16 on: May 04, 2010, 11:57:15 AM »

Course Sheila, thats what this thread is for, if someone has it and has good info on it I can prune out our ramblings and add the info to our list Wink
Logged

Yellow friend
Forum Member
***
Posts: 219



WWW
« Reply #17 on: May 04, 2010, 12:01:51 PM »

I'm so pleased - I think it's about $22 so not cheap but if I can learn something intrinsically different - I'm happy to pay up.  I bought the Michael Barley Baleen tutorial & it has transformed what I do (at the moment) Smiley
Logged

saffie
Guest
« Reply #18 on: May 04, 2010, 02:04:17 PM »

I have Lydia Muell Black Tie Event tut and love it! easy to read and follow and a few others I will check which ones later and let you know how I found them!
Logged
helenfc
....Dotty....
Forum Member
****
Posts: 449


Rocking Raku


WWW
« Reply #19 on: May 04, 2010, 04:51:46 PM »

i bought sarah horniks goldstone tutorial last night; i LOVE it!
available: www.glassbysarah.com
about 18
'11 Things to do with Goldstone'
11 awesome projects, 70-something pages
including a history of goldstone, inspiration and beginner to advanced projects.
highly recommended  Grin
Logged

Veebee
Superglassyfrittylisticgirlmakes beadsatrocious!
Forum Member
****
Posts: 392


Serial HotHead on bulk user and glass murderess.


WWW
« Reply #20 on: May 04, 2010, 04:57:11 PM »

I'll update with specs, links etc, but Anouk's armadillo tutorial is great, and has twistie and murrini tutorials thrown in as part of it.
Logged

Web: http://www.veebeads.net
The UK home of Val Cox frit!!
Fritt Flickr group: http://www.flickr.com/groups/1647822@N25/
saffie
Guest
« Reply #21 on: May 05, 2010, 08:17:22 AM »

As listed by Maria Louisa
Black petal motif tutorial by Lydia Muell fab easy to read and understand!

Reduction glass by storm, again fab easy to read shame I am useless at doing it!!!

Not sure if this one was mentioned
Kerri Fuhr - Tapestry scrollwork tutorial. again good easy to read and clear instructions

http://www.kerrifuhr.com/tutorials.html

Spiral wrap (free tut)
http://www.jaychantell.com/spiralwrap.pdf

Cauldron creations (again free)
http://www.cauldroncreations.com/tutorialindex.html
Logged
Yellow friend
Forum Member
***
Posts: 219



WWW
« Reply #22 on: May 08, 2010, 05:18:48 AM »

Bought the Lydia Muell 'Encased Floral Panel' tutorial as per Maria Louisa's list.  Easy to follow - took about an hour to make.  Needs a steady hand and a little patience - have posted a couple of my results on the May 2nd-9th Show & Tell - would def try one of her other tutorials.
Logged

Jolene
Forum Member
*******
Posts: 1032



WWW
« Reply #23 on: May 13, 2010, 04:44:23 PM »



Intermediate Tutorial, facial sculpting, on ETSY http://www.etsy.com/view_listing.php?listing_id=33549098

On Artfire http://www.artfire.com/modules.php?name=Shop&sc_id=54001&seller_id=42094&op=new

On the Web http://BeadsBot.com
Logged

Pages: 1 [2]
  Print  
 
Jump to:  

Powered by MySQL Powered by PHP Powered by SMF 1.1.21 | SMF © 2015, Simple Machines Valid XHTML 1.0! Valid CSS!
Page created in 0.038 seconds with 18 queries.