Frit-Happens !
June 13, 2021, 09:58:02 AM *
Welcome, Guest. Please login or register.

Login with username, password and session length
your ad here
Where are you?? Add yourself to the NEW FHF map here  | On flickr? Join our Frit Happens group: here

Get FH Status updates via twitter @FritHappens

   Home   Help Search Calendar Login Register  
Pages: 1 [2]
Author Topic: Tutorials- the why, the where and the how.  (Read 79942 times)
0 Members and 1 Guest are viewing this topic.
Yellow friend
Forum Member
Posts: 219

« Reply #15 on: May 04, 2010, 11:47:41 AM »

Has anybody tried Lydia Muell's

Encased Floral Panel Tutorial (Encased Floral Panel Series)

(am I allowed to ask this question?)


Forum Member
Posts: 1300

« Reply #16 on: May 04, 2010, 11:57:15 AM »

Course Sheila, thats what this thread is for, if someone has it and has good info on it I can prune out our ramblings and add the info to our list Wink

Yellow friend
Forum Member
Posts: 219

« Reply #17 on: May 04, 2010, 12:01:51 PM »

I'm so pleased - I think it's about $22 so not cheap but if I can learn something intrinsically different - I'm happy to pay up.  I bought the Michael Barley Baleen tutorial & it has transformed what I do (at the moment) Smiley

« Reply #18 on: May 04, 2010, 02:04:17 PM »

I have Lydia Muell Black Tie Event tut and love it! easy to read and follow and a few others I will check which ones later and let you know how I found them!
Forum Member
Posts: 449

Rocking Raku

« Reply #19 on: May 04, 2010, 04:51:46 PM »

i bought sarah horniks goldstone tutorial last night; i LOVE it!
about 18
'11 Things to do with Goldstone'
11 awesome projects, 70-something pages
including a history of goldstone, inspiration and beginner to advanced projects.
highly recommended  Grin

Superglassyfrittylisticgirlmakes beadsatrocious!
Forum Member
Posts: 392

Serial HotHead on bulk user and glass murderess.

« Reply #20 on: May 04, 2010, 04:57:11 PM »

I'll update with specs, links etc, but Anouk's armadillo tutorial is great, and has twistie and murrini tutorials thrown in as part of it.

The UK home of Val Cox frit!!
Fritt Flickr group:
« Reply #21 on: May 05, 2010, 08:17:22 AM »

As listed by Maria Louisa
Black petal motif tutorial by Lydia Muell fab easy to read and understand!

Reduction glass by storm, again fab easy to read shame I am useless at doing it!!!

Not sure if this one was mentioned
Kerri Fuhr - Tapestry scrollwork tutorial. again good easy to read and clear instructions

Spiral wrap (free tut)

Cauldron creations (again free)
Yellow friend
Forum Member
Posts: 219

« Reply #22 on: May 08, 2010, 05:18:48 AM »

Bought the Lydia Muell 'Encased Floral Panel' tutorial as per Maria Louisa's list.  Easy to follow - took about an hour to make.  Needs a steady hand and a little patience - have posted a couple of my results on the May 2nd-9th Show & Tell - would def try one of her other tutorials.

Forum Member
Posts: 1032

« Reply #23 on: May 13, 2010, 04:44:23 PM »

Intermediate Tutorial, facial sculpting, on ETSY

On Artfire

On the Web

Pages: 1 [2]
Jump to:  

Powered by MySQL Powered by PHP Powered by SMF 1.1.21 | SMF © 2015, Simple Machines Valid XHTML 1.0! Valid CSS!
Page created in 0.036 seconds with 18 queries.